SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000009252 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000009252
Domain Number 1 Region: 173-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000833
Family HkH motif-containing C2H2 finger 0.012
Further Details:      
 
Domain Number 2 Region: 124-166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000286
Family HkH motif-containing C2H2 finger 0.0018
Further Details:      
 
Domain Number 3 Region: 237-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000516
Family C2HC finger 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000009252   Gene: ENSPCAG00000009931   Transcript: ENSPCAT00000009914
Sequence length 264
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2081:4396:49451:1 gene:ENSPCAG00000009931 transcript:ENSPCAT00000009914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYDALGSLAAADGGEAGPYHRSEEVESQEPNEAGRLWETESETQPAGREEAPLFPTCXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXKSSRSKDKNQCCPICNMTFSSPVVALSHYLGKTHAKNLKLKQQSTKVEALHQNRDMI
DPDKFCSLCHATFNDPVMAKQHYVGKKHRKQETKLKLMAHYGRLADPAVTDSSAGKGYPC
KTCKIVLNSIEQYQAHVSGFKHKK
Download sequence
Identical sequences ENSPCAP00000009252 ENSPCAP00000009252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]