SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000009334 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000009334
Domain Number 1 Region: 824-992
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.62e-46
Family Eukaryotic proteases 0.00000135
Further Details:      
 
Domain Number 2 Region: 339-494
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-31
Family MAM domain 0.0064
Further Details:      
 
Domain Number 3 Region: 515-581
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-16
Family Spermadhesin, CUB domain 0.004
Further Details:      
 
Domain Number 4 Region: 665-765
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000432
Family Scavenger receptor cysteine-rich (SRCR) domain 0.016
Further Details:      
 
Domain Number 5 Region: 246-330
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000118
Family Spermadhesin, CUB domain 0.0039
Further Details:      
 
Domain Number 6 Region: 634-672
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000055
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 183-222
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000851
Family LDL receptor-like module 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000009334
Domain Number - Region: 92-116
Classification Level Classification E-value
Superfamily SEA domain 0.0235
Family SEA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000009334   Gene: ENSPCAG00000009849   Transcript: ENSPCAT00000010000
Sequence length 992
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4630:5:119490:-1 gene:ENSPCAG00000009849 transcript:ENSPCAT00000010000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLKRPVSSKCHSLSSYEVMFAALFVMLLVVCAGLIAVSWLGMNESEQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDEIFQSSNLKNEYKSSRVLQFXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNV
SVDCLPGFRLCADVLTCIATDLFCDGELNCADGSDEDSNICXXXXXGRFLTGSGSQAHIA
ISVSTIVCQWIIRVNPGLSVELSFPSFNISYSDTLNVYEGVGPSKILRASIWETHPGIIR
VFSDQVTITFLIESYGNEFTGFTATYTVFNSGDLNNYEKINCDFEDGFCFWIQDLNDDND
WERVQGSTFPPLSGPDFDHTLGNTLGFYISTPTGPGGIQERVRLLSLPLVLTLEPACLGF
WYYMYGENVYKLSINVSTEQNMEKTIFQKEGNYGENWNYGXXXXXXXXXXXVAFDAFKNG
LMSDIALDDITLTGICNTSLYPTLVPTVPPELPTDCGGPFELWEPNTTFSSMNFPNNYPN
EAFCVWNLNAQTGKNIQLHFQEFELENIADVVEIRDGRGDDSLFLXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPCKEDNFQCKNGECVPLATLCDGYSHC
HDGSDEAYCVRLVNGTMNSNGLVQFRIQNTWYAACAENWTTQISNDVCQLLGLGSENSSV
PILSTGDGPFVTLNTAPNGSLITPSENCSQDLLILLQCDHKACGKRXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRNLEPSKWNAILGLHTKSNM
TSQVVTRLVDQIVINPHYNKRSHDGDIAMMHLELKVNYTDYIQPICLPEENQVFPPGMNC
SITGWGTVEYQGAPADILQEAVVPLISNDRCQQQMPEYNITEYMLCAGYQEGGIDTCQGD
SGPLMCQEDNWFLAVTSYGYQCARPNPRVYAR
Download sequence
Identical sequences ENSPCAP00000009334 ENSPCAP00000009334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]