SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000009782 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000009782
Domain Number 1 Region: 46-242
Classification Level Classification E-value
Superfamily L domain-like 1.09e-27
Family Internalin LRR domain 0.023
Further Details:      
 
Domain Number 2 Region: 535-630
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.86e-26
Family Calponin-homology domain, CH-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000009782   Gene: ENSPCAG00000010406   Transcript: ENSPCAT00000010483
Sequence length 673
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_1620:36347:46067:-1 gene:ENSPCAG00000010406 transcript:ENSPCAT00000010483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVAAPLAAGGEEAAATTSVPGSAGLPGSRSAERALEEAVATGTLNLSNRRLKQFPRG
AARSYDLSDITQADLSRNRFPEVPEAACQLVSLEGLSLYHNCLRCLNPALGNLTALTYLN
LSNQLSLLPPYICQLPLRVLIISNLGVLSDIGVLGSLLDVSSNELQSLHELCSLPSLRDL
NVRRNQLSFLPDELGDLPLVRLDFSCNRVSRIPVSFCRLRHLQVILLDSNPLQSPPAQIC
LKGKLHIFKYLSTEAGQQGASALGDLAPSRPSSFSLCPAEDLFPGRRYDGGLDSGFHSVD
SGSKRWSGNESADEFSELSFRISELAREPRGPRERREDGLADGDPEQVDFIDNHVPGEDE
DRGAAEEQRPPELSAMARSGERAASNRREETTGEERRRPDTLQLWQERERRQQQQQQQSG
VWGTPRKDSFLKLGIRAAGGGTAVPSTQATSNGTPKSIGTQPEALGEQGAPAPAPASQEA
LPKAGTATAPVPRPLGSIQRPNSFLFRSSSQGSSGPPSPDSLLKPRRSPQVLDEKELMVQ
LRQVLESRLQRPLPEDLAEALANGVILCQLANQLRPRSVPFIHVPSPAVPKLSALKSRKN
VESFLEACRKMGVPEADLCSPSDLLQGTAQGLRTTLEAMQRVGGGVPPPLWPPPGLGGFL
LFYMAFVLLLYVT
Download sequence
Identical sequences ENSPCAP00000009782 ENSPCAP00000009782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]