SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000009829 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000009829
Domain Number 1 Region: 26-209
Classification Level Classification E-value
Superfamily L domain-like 1.53e-39
Family Ngr ectodomain-like 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000009829   Gene: ENSPCAG00000010583   Transcript: ENSPCAT00000010535
Sequence length 440
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6792:5399:7177:-1 gene:ENSPCAG00000010583 transcript:ENSPCAT00000010535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPAGCCVELLLLLLAGELPLTGGCPRDCVCYPAPMTVSCQAHNFAAVPEGIPEDSERIF
LQNNRITLLQQGHFSPAMVTLWIYSNNITFIDPNTFEGFVHLEELDLGDNRQLRMLAPET
FQGLVKLHALYLYKCGLSTLPAGIFSGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFL
HGNKLWSLGQDTFRGLVNLDRLLLHENQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGKCARRTPIRAPSVQQASS
ATSLGASLLAWILGLVVTLR
Download sequence
Identical sequences ENSPCAP00000009829 ENSPCAP00000009829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]