SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000009991 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000009991
Domain Number 1 Region: 230-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000104
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000009991   Gene: ENSPCAG00000010738   Transcript: ENSPCAT00000010708
Sequence length 300
Comment pep:known_by_projection scaffold:proCap1:scaffold_60:14943:123258:-1 gene:ENSPCAG00000010738 transcript:ENSPCAT00000010708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDC
FLHASPPPCIEESFRRLDPLLLPVEATVCEKSSAVDILLSRDKLLSETCLSLQPTSSSLD
SYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGG
VPTAAAAVAAAGTVKSGQSDSEQGGVGAEACPENKKRVHRCQFNGCRKVYTKSSHLKAHQ
RTHTGEKPYKCSWEGCEWRFARSDELTRHYKHTGAKPXXXXXXXXCFSRSDHLALHMRHI
Download sequence
Identical sequences ENSPCAP00000009991 ENSPCAP00000009991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]