SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000010030 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000010030
Domain Number 1 Region: 668-756
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.52e-25
Family Eukaryotic proteases 0.0000106
Further Details:      
 
Domain Number 2 Region: 228-333
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-20
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 3 Region: 88-172
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000248
Family SEA domain 0.01
Further Details:      
 
Domain Number 4 Region: 452-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 340-373
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000144
Family Spermadhesin, CUB domain 0.0057
Further Details:      
 
Domain Number 6 Region: 488-524
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000010030
Domain Number - Region: 418-454
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000249
Family Spermadhesin, CUB domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000010030   Gene: ENSPCAG00000010697   Transcript: ENSPCAT00000010749
Sequence length 756
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4308:5939:39077:1 gene:ENSPCAG00000010697 transcript:ENSPCAT00000010749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNNRARKGGAGAKHWDADLKYSSSQHQNMNGFEEAVEFLPVNNAKKVEKRSRRCWVVLA
AMVTVFFLLSLVVGVLVWHFQYRNVGVQKVFNGHLRIKNEEFVDAYENSSSTEFAHLASK
VKEALKLLYGGIPALGPYHKGSTVTAFSEGSVIAYYWSEFSIPQHLVEEAEHAMAEEHMV
TMPPRARALQSVVLTSVVAFXXXXXXXXXXXXXSCSFALHAHGREWTRFTTPGFPDSPYP
EHAHCQWALRGDADSVLSLTFRSFDLAPCDERGSDLVMVYDSLSPIEPHAVVQLCGTYPP
SYNLTFLSSQNVFLVTLVTSTERRHPGFEATFFQLPKMSSCGGYLHQTQGTFSSPYYPGH
YPPNIDCTWNIEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQFVVG
NSNKITVHFHSDQSYTDTGFLAEYLSYDSTDPCPGMFTCNTGRCIQRTLRCDGWADCADF
SDELNCVCNTTHQFTCKNTLCKPLFWICDSVNDCGDNSDELVCXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXYSDPTVWTAFLGLHDQSKRSAPGVQEHKLKRIIRHPNFNDFTYDYDLALLELEKP
AQYSNVVRPICLPDATHVFPAGKAIWVTGWGHTQEG
Download sequence
Identical sequences ENSPCAP00000010030 ENSPCAP00000010030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]