SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000010156 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000010156
Domain Number 1 Region: 72-249
Classification Level Classification E-value
Superfamily L domain-like 2.82e-37
Family Ngr ectodomain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000010156   Gene: ENSPCAG00000010912   Transcript: ENSPCAT00000010887
Sequence length 333
Comment pep:known_by_projection scaffold:proCap1:scaffold_6156:5776:12266:-1 gene:ENSPCAG00000010912 transcript:ENSPCAT00000010887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILRPTFQVFGPCSCLHVSPALESTDAALMSSLQHCRMSDTCAQLPWPRPLHPAMLLVSLL
LAVGMMHSNAGTSCPVLCTCHNQVVDCSSQRLFSVPPDLPMDTRNLSLAHNRITTVPPGY
LTCYMELWVLDLRNNSLVELPPGLFLHAKRLAHLDLSYNNLSHVPADMFREAHGLVHIDL
SHNPWLRRVHPQAFQGLVQLRDLDLSYGGLAFLSLALEGLPGLVTLQIGGNPWVCGCTME
PLLKWLRNRIQRCTADSQLAECRGPPEVEGAPLFSLTEESFKACHLTLTLDDYLFIAFVG
FVVSIASVATNFLLGITANCCHRWSKASEEEEI
Download sequence
Identical sequences ENSPCAP00000010156 ENSPCAP00000010156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]