SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000010301 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPCAP00000010301
Domain Number - Region: 75-119,324-370
Classification Level Classification E-value
Superfamily L domain-like 0.000204
Family mRNA export factor tap 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000010301   Gene: ENSPCAG00000011086   Transcript: ENSPCAT00000011035
Sequence length 376
Comment pep:novel scaffold:proCap1:scaffold_53643:10771:15573:1 gene:ENSPCAG00000011086 transcript:ENSPCAT00000011035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSFLCWLLPLLILASVTQGQPTRRPKLKPRVKPRPRPRPTPSFPQPDEPSEPTDLPPPL
PPGPPSVFPDCPRECYCPQDFPSALYCDSRNLRKVPVIPARIHYLYLQNNFISELPLESQ
NATGLINDNNRIRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXVNGTQICPNNLVAFHDFSSDLENVPHLRYLRLDGNYLKPPI
PLDLMMCFRLLQSVII
Download sequence
Identical sequences ENSPCAP00000010301 ENSPCAP00000010301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]