SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000010334 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000010334
Domain Number 1 Region: 277-462
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.2e-37
Family Nucleotide and nucleoside kinases 0.00044
Further Details:      
 
Domain Number 2 Region: 62-120
Classification Level Classification E-value
Superfamily L domain-like 0.000000000289
Family Internalin LRR domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000010334   Gene: ENSPCAG00000011009   Transcript: ENSPCAT00000011069
Sequence length 689
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4674:8158:135144:1 gene:ENSPCAG00000011009 transcript:ENSPCAT00000011069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCDLTDVNMLCGYVHLQKLDLSGNKIEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XKVDFSYNQISEMRDLSAYHALTRLILDNNEIEEIKGLEMCGNLTHLSLAKNKITAVQGL
SMLPIKILCLXXXXXXXXXXXXXXXXXXXXXXXSNHICSLQGLEGHDLLVLNLEDNKXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSAVNKY
DPPPEVIAAQDHLTHVVNSMMQPQRIFDSTLPSLDAPYPMLILAGPQACGKRELAHRLCR
QFSAYFRYGACHTTRPPYFGEGDRVDYHFISQEVFDEMLNMGKFILTFNYSNHNYGLNRD
TVEGIARDGLASCIHMEIEGVRSLKCSYFEPRYILVVPMNKPKYEGHLRRKGLFSRAEID
FAVSRVDLYMDINQTCPGYFDAVISADDLEVAYQELSKLIREYLGLSEEPAKGLASTDVP
TSLLESQQRPRKISTLNPCDFLDSTDRNYLLKLCTSHSTKITPTERDSVQRQHETARQAL
MGKIPPDHTLLFQRGPVPAPVISDICYLTQLGEPLGGFEFSDDYAVTSSGSQPGQXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSERSVSRERDSSL
WRKQTVPAVSYPGANTKPILPPIPQGRKY
Download sequence
Identical sequences ENSPCAP00000010334 ENSPCAP00000010334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]