SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000010525 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000010525
Domain Number 1 Region: 66-202
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000000155
Family Ngr ectodomain-like 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000010525
Domain Number - Region: 313-546
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0022
Family WD40-repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000010525   Gene: ENSPCAG00000011299   Transcript: ENSPCAT00000011272
Sequence length 554
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_1091:132448:167076:1 gene:ENSPCAG00000011299 transcript:ENSPCAT00000011272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAERSQRMGNACVPLKRIAYFLCLLSVLLLTEGKKPAKPKCPAVCTCTKDNALCENARA
IPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYL
FIETHNIKSISGHTFRIHLXXXXXXXXXXXXXXXXXXXXXXXXDLRGNSFNCDCKLKWLV
EWLDHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSIDTFSYL
NDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITXXXXXXXXMQPIVIETQLYVIVAQLF
GGSHIYKRDGFANKFIKIQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIYKWN
GNGFYSHQSLHAWYRDTDVEYLEIARTPQTFRTPHLILSSSSQRPVIYQWNKVTQLFTNQ
TDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGASFQDIQRMPSRGSMVFQPLQ
INNYQYAILGSDYSFTQVYNWDADKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKG
NTQIYKHVIVDLSA
Download sequence
Identical sequences ENSPCAP00000010525 ENSPCAP00000010525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]