SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000010548 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000010548
Domain Number 1 Region: 85-234
Classification Level Classification E-value
Superfamily L domain-like 9.18e-28
Family Leucine rich effector protein YopM 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000010548   Gene: ENSPCAG00000011225   Transcript: ENSPCAT00000011296
Sequence length 521
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4986:9291:24896:1 gene:ENSPCAG00000011225 transcript:ENSPCAT00000011296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPARVRALAPRPSTGSVRVQELSQPGLHNPCPQSKGADHQGAGHSEWLMEEYLSPARLQ
ALAQADDLLTVTVLEMCVDTRRNSLGNLGLHLPSLRQLKLNGSRLASVRDLGTSLGHLQV
LWLSCCGLPDLDGIGSFPGLKELYVSYNSISDLSPLCLLEQLEVLDLEGNRVEELGQVCY
LKLCPKLATLTLEGNLVCLCPSPASKAPPHYDYRAEVRQLLPQLQVLDEAPATQTGLPAT
QTLIQDWLLVKEVISVGNSPGSLLPRLGQPQGAPVQQQAPMLSLPEPRPWPSSPWPLSSL
LPGDALPEGLLPEDPASEDDASDLTHGAGHVLCGNPTKGLRQWRRQCQAWAPPERLHRPA
ALSAITSAPTLDTADSADRLALAELWTWRELCQHTLPCRHMVSPKERTAAPQGPRRCPEQ
QEDESGPRAAPGAPGLAPETLGDSGCKLIPSPPKHPPPGIGISSRSPTRASPFRGRRLRG
PPGAARALRALEVDCPQPAPSDTSRPSSACGPHHPSPSPTW
Download sequence
Identical sequences ENSPCAP00000010548 ENSPCAP00000010548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]