SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000010668 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000010668
Domain Number 1 Region: 67-267
Classification Level Classification E-value
Superfamily L domain-like 6.97e-28
Family Ngr ectodomain-like 0.0097
Further Details:      
 
Domain Number 2 Region: 462-544
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000122
Family Ngr ectodomain-like 0.007
Further Details:      
 
Domain Number 3 Region: 324-396
Classification Level Classification E-value
Superfamily L domain-like 0.000068
Family Ngr ectodomain-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000010668   Gene: ENSPCAG00000011430   Transcript: ENSPCAT00000011422
Sequence length 833
Comment pep:known_by_projection scaffold:proCap1:scaffold_5050:23842:26737:-1 gene:ENSPCAG00000011430 transcript:ENSPCAT00000011422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLWIHLFYSALLACASLQPESPAPSARGSCDTFCNCEEKDGTMLINCEDRGIQKLSQVS
VPPSRPFHLYLLNNGLTVLHANDFSELTNALSIHLGFNNIADIETSAFNGLDLLKQLHIN
HNSLEILKEDTHGLENLEFLQADNNFITVIEPSFSRLRLKVLILNDNAIESLPPNIFRFV
PLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKWACNCDLLQLKIWLENMPPQSIIG
DVVCNSPPAFKGSILSRLKKESICSTPPVYDEYEDPSGSLNLAVTTSIRDSLLSTKATFL
LKPPTKAPGLIPFIKPSTQLPGSYCPVPCNCKLLSPSGLLIHCQEHNIESLSDLKPPPHN
PRKLILAGNIIHTLMKSDLEEYFTLEMLHLGNNRIEIEEGXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLNNNLQVLPSRIFSGIPLTR
INLKTNQFSHLPVSNILDDLDLLTQIELEGNPWDCSCDLVGLQQWIQKLSKNMVTDDIIC
VSPGHLDKKELKALNSELLCPGLVNNPSLPSQPSYKVVTIPTATTNTGDTILRSLTDAVP
LSVLILGLLIVFITIVFCAAGIVVLVLHRRRRYKKKQVDEQIRDNSPVHLQYSMYGHKTT
HHMTERPSASLYEHQMVSPVVHVYRSPSFGPKHLEDEEERNEKEGGDAKHLQRSLLEREK
HPPLTEPSIKYTTDQPTELSFQDASSLYRNILEKERELQQLGITEYLRKNITQLQPDMEA
HYPGAHEELKLMERLMYSRSRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQT
Download sequence
Identical sequences ENSPCAP00000010668 ENSPCAP00000010668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]