SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000010682 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000010682
Domain Number 1 Region: 44-349
Classification Level Classification E-value
Superfamily L domain-like 4.71e-58
Family Ngr ectodomain-like 0.0004
Further Details:      
 
Domain Number 2 Region: 351-440
Classification Level Classification E-value
Superfamily Immunoglobulin 5.29e-17
Family I set domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000010682   Gene: ENSPCAG00000011473   Transcript: ENSPCAT00000011437
Sequence length 648
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_7150:364254:366510:-1 gene:ENSPCAG00000011473 transcript:ENSPCAT00000011437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLWQVTVHHTWNAVLLPVVYLTAQVWILCAATAAAASAGPQNCPSVCSCSNQFSKVVC
TRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNG
LASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGEL
KKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHGL
SSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNP
WNCDCDILWLAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQCSAPFIMDAPRD
LNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGV
YTCMVTNVAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTSTG
YQPAYTTSTTVLIQTTRVPKQVVPTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXKRHQQRSTVTAARTEIQVDEDIPAAASAAATAAPSGVSGEGAVVLPTIHDHI
NYNTYKLAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI
Download sequence
Identical sequences ENSPCAP00000010682 ENSPCAP00000010682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]