SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000010714 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000010714
Domain Number 1 Region: 177-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.69e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 215-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.13e-19
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 136-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000010714   Gene: ENSPCAG00000011505   Transcript: ENSPCAT00000011473
Sequence length 323
Comment pep:known_by_projection scaffold:proCap1:scaffold_14394:27664:32946:-1 gene:ENSPCAG00000011505 transcript:ENSPCAT00000011473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPVPKPYLTYLLDNGKELWRIKRGPSQSTNSGDRGKLPTREPTSSELLLFKEDMLQRSVT
QGFPKDSGLGKARDQEIQKGRLGTNLHKKTHPEKMRFEHDRWSTEESPHSRALQDRVFPE
DTLHTLDSHRPAVMSTGKNPYECRECGKSFNRKWNLTRHQQLHTGMKPYKCNKCEKVFSQ
SSTLIRHYLIHTGEKPFKCTECGKAFKRRSYLMXHTGEKPYECVQCGKAFHREANLIQHS
VIHTGEMPYKCIECGKAFRRRSHLMQHYQHILEELWECQEYRRAFPHCSCFSCNRIQTSE
LMKCNECGKASDYSLSYTRSHVD
Download sequence
Identical sequences ENSPCAP00000010714 ENSPCAP00000010714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]