SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000010747 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000010747
Domain Number 1 Region: 32-239
Classification Level Classification E-value
Superfamily L domain-like 1.02e-35
Family Ngr ectodomain-like 0.0032
Further Details:      
 
Domain Number 2 Region: 288-368
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000025
Family I set domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000010747   Gene: ENSPCAG00000011579   Transcript: ENSPCAT00000011506
Sequence length 508
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6097:246570:248096:-1 gene:ENSPCAG00000011579 transcript:ENSPCAT00000011506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWLVLLDTVLCMLCVGLATPDHPEALLPPTPHSCPDKCVCAADLLSCAGLGLRDVPAAI
PVAAADLDLSHNALQRLHPGWLAPLSRLRTLRLGHNKLGALGRGVFTNASSLRLLDLSSN
ALRALGRHDLDGLGALEVLLLFNNHLVHLDEHAFHGLGALKQLYLGCNKLASFSFSHLHG
LGTAHLRTLDLSSNQLGHIPVPELATLPAFLKDGLYLHNNPLPCNCSLYHLLQRWHQRGL
SAVRDFAGDYTCLAFKVPASRVRFFKHNRVFENCSAAAAHDLEHPEELLQVRVGQSLQLH
CNASAPALRTAWVSPKHELLLAPGSQDGSIQLLADGSLAISNVQLQHHGIFVCLATGPHL
HNQTHEYNVSVDAPLPESEVFNTSYTTLLGCAVGLVLVLLYLFMPPCRGCCRCCRQTCCC
RHWSRAPSPLQELSAQSSVLSTTSLEAPSRKASTHKHVVFLEPGRRGLNGRVQLAIAEDF
DLCDPGGLQLKVSSESASSTGSEGPVMT
Download sequence
Identical sequences ENSPCAP00000010747 ENSPCAP00000010747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]