SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000010760 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000010760
Domain Number 1 Region: 11-268
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-73
Family Protein kinases, catalytic subunit 0.0000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000010760   Gene: ENSPCAG00000011601   Transcript: ENSPCAT00000011521
Sequence length 273
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5595:42582:43403:-1 gene:ENSPCAG00000011601 transcript:ENSPCAT00000011521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRE
LSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRSGRIPGAQARDLFAQIA
GAVRYLHDHHLVHRDLKCENVLLSPDERRVKITDFGFGRQAHGYPDLSTTYCGSAAYASP
EVLLGIPYDPKKYDVWSLGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPDGLELPERC
KALIAELLQFSPSARPSAGQVARNGWLRAGDSG
Download sequence
Identical sequences ENSPCAP00000010760 ENSPCAP00000010760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]