SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000010790 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000010790
Domain Number 1 Region: 90-398
Classification Level Classification E-value
Superfamily L domain-like 2.13e-54
Family Leucine rich effector protein YopM 0.037
Further Details:      
 
Domain Number 2 Region: 491-631
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.94e-36
Family Gelsolin-like 0.00027
Further Details:      
 
Domain Number 3 Region: 611-722
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.07e-24
Family Gelsolin-like 0.00056
Further Details:      
 
Domain Number 4 Region: 886-945,981-1061
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.71e-23
Family Gelsolin-like 0.011
Further Details:      
 
Domain Number 5 Region: 1156-1262
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 9e-23
Family Gelsolin-like 0.00099
Further Details:      
 
Domain Number 6 Region: 751-859
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 8.89e-20
Family C-terminal, gelsolin-like domain of Sec23/24 0.01
Further Details:      
 
Domain Number 7 Region: 7-118
Classification Level Classification E-value
Superfamily L domain-like 3.16e-19
Family Polygalacturonase inhibiting protein PGIP 0.056
Further Details:      
 
Domain Number 8 Region: 1055-1147
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.000000000000795
Family Gelsolin-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000010790   Gene: ENSPCAG00000011407   Transcript: ENSPCAT00000011552
Sequence length 1267
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_1043:58491:71347:-1 gene:ENSPCAG00000011407 transcript:ENSPCAT00000011552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESTGVLPFVRGVDLSGNDFKGGYFPENVKAMTSLRWLKLNHTGLCYLPEELSALQKLEH
LSVSHNNLTTLHGELSSLPSLRAIVARANSLKNSGVPDDIFKLDDLSVLDLSYNQLTECP
RELENAKNMLVLNLSHNSIDTIPNQLFINLTDLLYLDLSENRLESLPPQMRRLVQLQTLV
LNGNPLLHAQLRQLPAMLSLQTLHLRNTQRTQSNLPTSLEGLSNLADVDLSCNDLARVPE
CLYTLPSLRRLNLSSNQITELSLCIDQWTHIETLNLSRNQLTSLPSAICKLSKLKKLYLN
SNKLDFDGLPSGIGKLANLEEFMAANNNLELIPESLCRCTKLKKLILNKNRLVTLPEAIH
FLTEIEVQVLDVRENPSLVMPPKPADHAAEWYNIDFSLQNQLRLAGASPATVAAAAAAGS
GPKDPLARKMRLRRRKDSAQDDQAKQVLKGMSDVAQEKNKKQEESTDTPGSGGKVRRWDQ
SLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDS
GSLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDI
SYIEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGASLDPRFVFLLDRGLDIYV
WRGAQATLGSTTKARLFAEKINKNERKGKAEITLLAQGQEPAEFWEALGGEPPEIKKHVP
DDFWPPSPKLYKVGLGLGYLELPQINYKLSVEHKTRPKVELMPGMRLLQSLLDTRCVYIL
DCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHAAVSRSLEGTEAQVFKAKFKNW
DDVLTVDYTRNAEAVIQGQGLTGKVKHDTEKKDQMKADLTALFLPRQPPMALAEAEQLME
EWNEDLDGMEGFVLEGKKFARLPEEEFGHFYTQDCYVFLCRYWVPVEYEEEEKKEDDEGE
KARAESKAGEEAMVEEKQPEEDFQCIVYFWQGREASNMGWLTFTFSLQKKFESLFPGKLE
VVRMTQQQENPKFLSHFKRKFIIHRGKRKMSQGTLQPSLYQIRTNGSALCTRCIQISTDS
SLLNSEFCFILKVPFESEDNQGIVYAWVGRASDPEEAKLAEDILNTMFDTSYSKQVINEG
EEPNFWVGLAAQPYDDDAEYMHTRLFQCNEKGFFAVTEKCSDFCQDDLADDDIMLLDNGQ
EVYMWVGTQTSQVEIKLSLKACQVYIQHLRSKEQERPRRLRLVRKGNEQHAFTRCFHAWS
TFRKALA
Download sequence
Identical sequences ENSPCAP00000010790 ENSPCAP00000010790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]