SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000011050 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000011050
Domain Number 1 Region: 67-309
Classification Level Classification E-value
Superfamily L domain-like 4.99e-37
Family Internalin LRR domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000011050   Gene: ENSPCAG00000011878   Transcript: ENSPCAT00000011830
Sequence length 342
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_122:8190:13060:1 gene:ENSPCAG00000011878 transcript:ENSPCAT00000011830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDEDDLEDFELYQDDLEKEDEEETEEGEEYRREEEEFTEDWMPNALTEELMKEGLSLLC
KTGNGLAHAYVKLELKERDLTDISLLRSYIHLRYVDISENHLTDLSPLNNLTHLLWLKAD
GNGLRSVRLDELPYLQIASFAYNQITDTEGISHPRLVSLDLKGNRIHMVTGLDPQKLNSL
HTLELRGNQLETTQGINLPKLKNLYLAQNMLKKVEGLENLSNLTTLHLRDNQIETLSGFS
GEMKSLQYLNLRGNMITDLAELAKLRDLPKLRALVLLENPCTDESDYRQEALVQMAHLER
LDKDFYEEEERAEADEIRQRMKEDQEHKSEQGHGEDLDQSTN
Download sequence
Identical sequences ENSPCAP00000011050 ENSPCAP00000011050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]