SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000011091 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000011091
Domain Number 1 Region: 151-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-17
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 123-163
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000653
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 3 Region: 193-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000331
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000011091   Gene: ENSPCAG00000011934   Transcript: ENSPCAT00000011873
Sequence length 237
Comment pep:known_by_projection scaffold:proCap1:scaffold_36884:315:5993:1 gene:ENSPCAG00000011934 transcript:ENSPCAT00000011873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTFQQPYDQAHLLAAIPPPEVLNPTASLPTLIWDSLLVPHVQPGGWASLRPQEGPKAAEL
TSLSDEDSGKGSQPPSPPSPASSSFSSGSASSLEAEAYAAFPGLGQVPKQLAVLAVAKDP
QSRKAFNCKYCDKEYVSLGALKMHIRSHTLPCVCDTCGKAFSRPWLLQGHVRTHTGEKPF
SCSHCSRAFADRSNLRAHLQTHSAVKKYQCKTCSRTFSRMSLLHKHEESGCSGGPRG
Download sequence
Identical sequences ENSPCAP00000011091 ENSPCAP00000011091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]