SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000011260 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000011260
Domain Number 1 Region: 750-902
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.7e-33
Family Toll/Interleukin receptor TIR domain 0.00031
Further Details:      
 
Domain Number 2 Region: 29-140,215-332
Classification Level Classification E-value
Superfamily L domain-like 1.33e-32
Family Ngr ectodomain-like 0.018
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000011260
Domain Number - Region: 644-697
Classification Level Classification E-value
Superfamily L domain-like 0.00972
Family Ngr ectodomain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000011260   Gene: ENSPCAG00000012102   Transcript: ENSPCAT00000012057
Sequence length 905
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5286:17781:27655:1 gene:ENSPCAG00000012102 transcript:ENSPCAT00000012057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQGLPCHISSFCRLSLLWMLCTSSANKCTVRHEVADCSHLKLTQIPDDLPTNITVLNLT
HNQLRRLPAANLTRYNQLLVLDGGFNSISKLESELCQKLPLLRVLNLQHNELSRLSDKTF
VYCTNLTELHLMSNSIQTIQNNPFKSLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFSPGCFHAIGRLFGLFLNNVQLDPGLTE
KLCVELSNTSIRSLSLSNTRLYRTSNMTFFGLKQTNLTTLDLSHNSLNVIANDSFAWLPR
LEYFTLEYNSIGHLFSRSFYGLFNVRFLNLKRSXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMRFNPFDCTCESIAWFVN
WTNGTHANISGLPDDYLCNTPPHYHGLPVTLFDTSACKDSAPFELLFIINTSTLLLFIFL
VLLTHFEGWRLSFYWNVSVHRILGFKEVDRQEEQFEYAAYVIHAHKDRDWVWQHFSPMEE
EDQSLRFCLEERDFEAGTLELEAIVNSIKRSRKIIFVITQHLLKDSLCKRFKVHQAVQQA
IEQNLDSIILIFLEEIPDYKLNHALCLRRGMFKSRCILKWPVQKERISAFHHKLQVALGS
RNSAH
Download sequence
Identical sequences ENSPCAP00000011260 ENSPCAP00000011260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]