SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000011283 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000011283
Domain Number 1 Region: 96-259
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-33
Family Eukaryotic proteases 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000011283
Domain Number - Region: 16-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000196
Family LDL receptor-like module 0.0039
Further Details:      
 
Domain Number - Region: 53-105
Classification Level Classification E-value
Superfamily SRCR-like 0.000628
Family Hepsin, N-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000011283   Gene: ENSPCAG00000012058   Transcript: ENSPCAT00000012082
Sequence length 264
Comment pep:novel genescaffold:proCap1:GeneScaffold_3474:6271:19497:1 gene:ENSPCAG00000012058 transcript:ENSPCAT00000012082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVILDTYCFIFRQPLHFIPREQMCDGQQECALGEDEQQCVQNDTDGPLVVHLSKDSTLQV
PNPTTGPWASTCFDSFTETLAKIACGQVASRRLCLSDSLVSLHCVVCGESLKAPRVVGGE
FTAAHCFDVTNWKVRVGSDKLDTFPSLPVVEIITEPNTVYPNENHIAFMKLQFPFTFSGT
VRPICLPFSDEELPTTPLWIIGWGFTEENGVEVGDSGGPVMYSAQWQVVGIVNWGYGGGQ
STPGVCTRVTACLSWIYGVRKAEL
Download sequence
Identical sequences ENSPCAP00000011283 ENSPCAP00000011283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]