SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000011322 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000011322
Domain Number 1 Region: 98-154
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000586
Family V set domains (antibody variable domain-like) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000011322   Gene: ENSPCAG00000012185   Transcript: ENSPCAT00000012126
Sequence length 198
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_3474:49325:67099:-1 gene:ENSPCAG00000012185 transcript:ENSPCAT00000012126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVGIRGGALTRWLDTGLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXLIEGTVKNEKSDPKVKKSKDNDRITLVGFTKEKANNLSILLK
DLEFSDTGKYTCHVKNPKEKDLQHQATIFLHVVDKLEEVDNTVTLIILAVVGGVIGFLTL
ILLLKKFITFILKKTQEK
Download sequence
Identical sequences ENSPCAP00000011322 ENSPCAP00000011322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]