SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000011432 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000011432
Domain Number 1 Region: 645-755
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.75e-25
Family Calponin-homology domain, CH-domain 0.0023
Further Details:      
 
Domain Number 2 Region: 88-216
Classification Level Classification E-value
Superfamily L domain-like 7.14e-25
Family Internalin LRR domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000011432   Gene: ENSPCAG00000012170   Transcript: ENSPCAT00000012242
Sequence length 765
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2929:10681:95587:-1 gene:ENSPCAG00000012170 transcript:ENSPCAT00000012242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASQGGGGNSGGGGCGGGGSSSGCGAAGGGGGAAGGGGGGGAGTLAVPIPVPTLYGQPF
PNGPQWNPGSLQPQHTVRSLDRALEEAANSGILSLSGRKLREFPSCGYDLTDTTQADLSR
NRFTEIPSDVWLFAPLETLNLYHNCIKSIPEAIKNLQMLTYLNISRNLLSTLPKYLFDLP
LKVLVISNNKLVSIPEEIGKLRELMELDISCNEIXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICLKGKVHIFKY
LSMQACCRMDKKPDSLDLPSLSKRIPSQPLTDSMEDFYPNKNHGPDSGIGSDNGEKRLST
TEPSDDDTISLHSQVSESNREQTSRNDSHSMGSKPDSQKXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL
LQQEQKTRILNHSTCVTRNKPKQTVEGEKSVLADEGNSPLSPLTWQPLENQKDQIEEQQW
PESQPIIWQNEERRRSKQIRKEYFKYKSSRKSSSGNENDEXXXXXXXXXXXXXXXXXEYD
RTDGFSHGPFGLKPRSAFSRSPRQEYGAADPGFTMRRKMEHLREEREQIRQLRNNLESRL
KVILPDDIGAALMDGVILCHLANHIRPRSVASIHVPSPAVPKLSMAKCRRNVENFLDACK
KLGVSQERLCLPHHILEERGLVKVGVTVQALLELPTTKASQLSTA
Download sequence
Identical sequences ENSPCAP00000011432 ENSPCAP00000011432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]