SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000011500 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000011500
Domain Number 1 Region: 73-252
Classification Level Classification E-value
Superfamily L domain-like 8.5e-38
Family Ngr ectodomain-like 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000011500   Gene: ENSPCAG00000012336   Transcript: ENSPCAT00000012314
Sequence length 311
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5026:11225:43166:-1 gene:ENSPCAG00000012336 transcript:ENSPCAT00000012314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVPCGSPEPPPALLGQRGPLGLAPPRHSRRTRALQPLAAAWARTRMSRGLRLHRPAHGGL
SRGLPSVPDPFPLDVRKLLVAGNRIQEIPEDFFIFYGDLVYLDFRNNSLRSLEEGTFSGS
AKLAFLDLSYNNLTQLGAGAFRSAGRLVKLSLANNHLAGVHEAAFESLESLQVLELNDNN
LRSLSAAALDALPALRTLRLDGNPWLCDCDFAQLFSWIQENASKLPKGLDEIQCSLPTEN
RRIFLQELSEASFSECKFSLSLTDLFIIIFSGVAVSIAAIISSFFLATVVQCFQRCAPNK
DTGDEEEDEDD
Download sequence
Identical sequences ENSPCAP00000011500 ENSPCAP00000011500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]