SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000011693 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000011693
Domain Number 1 Region: 25-293,362-401
Classification Level Classification E-value
Superfamily L domain-like 9.07e-46
Family Leucine rich effector protein YopM 0.096
Further Details:      
 
Domain Number 2 Region: 1440-1498
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000399
Family PDZ domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000011693   Gene: ENSPCAG00000012424   Transcript: ENSPCAT00000012516
Sequence length 1498
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_257:5185:260539:1 gene:ENSPCAG00000012424 transcript:ENSPCAT00000012516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTKRKIIGRLVPCRCFRGEEEIISVLDYSHCSLQQVPKEVFNFERTLEELYLDANQIEE
LPKQLFNCQALRKLSIPDNDLSSLPTTIASLVNLKELDISKNGVQEFPENIKCCKCLTII
EASVNPISKLPDGFTQLLNLTQLYLNDAFLEXXXXXXXXXXXXXXXXXXXXXXXXXXXSM
HKLAQLERLDLGNNEFSELPEVLDQIQNRELWMDNNLQVLPGSIGKLKMLVYLDMSKNRI
ETVDMEISGCEALEDLLLSSNMLQQLPDSIGLLKKLTTLKVDDNQLTMLPNTIGXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGSCKNVTVMSLRSNKLEFLPE
EIGQMQKLRVLNLSDNRLKNLPFSFTKLKELAALWLSDNQSKALIPLQTEAHPETKQRVL
TNYMFPQQPRGDEDFQSDSDSFNPTLWEEQRQQRMTVAFEFEEKKEDEENAGKVKXXXXX
XXXERGQRGITLQPARLSGDCCTAWARCDQQIQDMPVPQNDPQLAWGCLSGLQQERSMCT
PLPVAAQSTTLPSLSGRQVEINLKRYPTPYPEDLKNMVKSVQNLVGKPSHGVRVENSNPT
ANTEQTVKEKYEHKWPVAPKEITVEDSFVHPANEMRIGELHPSLAETPLYPPKLVLLGKD
KKESTDESEVDKTHCLNNSVSSGTYSDYSPSQASSASSNTRVKVGSLQTTAKDAVHNSLW
GNRIAQSFPQPLDSKPLLSQREAVPPGNLPQRPERLPMSDTFTDNWTDGSHYDNTGFVAE
ETTAENANNNPLLSSKSRSTSSHGRRPLIRQDRIVGVPLELEQSIHRHTPETEVPPSNPW
QNWTRTPSPFEDRTAFPSKLETTPTTSPLPERKEHIKESTEMPSPFSPGVPEYHDSNPNR
SLSNVFSQIHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTYGGSKPQQQKASMT
KKVYQFDQSFNPTGAVEVKAEKRIPPPFQHNSEYMQQSSKNIAKDLVSPRGYRGYPPMEQ
MFSFSQPSVNEGAVVNAQFASQGSRAGFLRRADSLVSATEMAMFRRVSEPHELPPSDRYS
RPPYRGGLDRQSSVSVTESQFLKRNGRYEDEHPSYQEVKAQAGSFPVKNLIQRRPLSARS
YSTESYGASQTRPVSARPTMAALLEKIPSDYNLGNYGDKPSDNSDIKPRPTPVKGEEICG
KMPADWRQQLLRHIEARRLDRNAAYKHNTVNLGMLPYGGISSMHAGRSMTLNLQTKSKFD
HQELPLQKTPSQQSNILDNGQEDVSPSGQWNPYPLGRRDVPPDTITKKAGSHIQTLMGSQ
SLQHRSREQQPYEGNVNKVTIQQFQSPLPIQIPSSQATRGPQPGRCLIQTKGQRSMDGYP
EQFCVRIEKNPGLGFSISGGISGQGNPFKPSDKGIFVTRVQPDGPASNLLQPGDKILQ
Download sequence
Identical sequences ENSPCAP00000011693 ENSPCAP00000011693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]