SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000011787 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000011787
Domain Number 1 Region: 41-267,337-367,477-530
Classification Level Classification E-value
Superfamily L domain-like 6.29e-50
Family Internalin LRR domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000011787   Gene: ENSPCAG00000012591   Transcript: ENSPCAT00000012615
Sequence length 602
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_257:298649:354738:-1 gene:ENSPCAG00000012591 transcript:ENSPCAT00000012615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQKPAAGRDPRAGFRAEQRDCPTSVPQGLLKAARKSGQLNLSGRNLSEVPQCVWRINV
DIPEEANQNLSFGATERWWEQTDLTKLIISNNKLQALTDDLRLLPALTVLDIHDNQLTSL
PSAIRELENLQKLNVSHNKLKMLPEEITNLRNLKGLYLQHNELTCIPEGFEQLSSLEDLD
LSSNRLTSVPATFSSLPSLVRLNLSSNQLKSLPAEISRMKRLKHLDCNSNLLETIPSELA
GMESLELLYLRRNKLHSLPPFPSCTLLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXLPYSLGNLHLKHLALEGNPLRTIRREIVNKGTQE
VLKYLRSKIRDDGPPPNDCVTETAMTLPSESRVNVHAITTLKILDYXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
NNFLTSLPEEMQSLIRLQMINLSFNRFKILPEVLYRIPTLETILISNNQVGSMDXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXTLLLDGNPFRVPRAAILVKGTAAILEYLRDRI
PT
Download sequence
Identical sequences ENSPCAP00000011787 ENSPCAP00000011787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]