SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000011916 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000011916
Domain Number 1 Region: 423-779
Classification Level Classification E-value
Superfamily L domain-like 1.7e-49
Family Internalin LRR domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000011916   Gene: ENSPCAG00000012805   Transcript: ENSPCAT00000012755
Sequence length 803
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5937:35358:56022:1 gene:ENSPCAG00000012805 transcript:ENSPCAT00000012755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPVTEFRQFSEQQPAFRVLKPWWDVFTDYLSVAMLMIGVFGCTLQVMQDKIICLPKRVP
PSQNHSSVSNVSQAVASTTPLPPPKPSATNPATVEMKGLKTDLDLQQYSFINQICYERAL
HWYAKYFPYLVLIHTLVFMLCSNFWFKFPGSSSKIEHFISILGKCFDSPWTTRALSEVSG
EDSEEKDNRKNNMSRSNTIQSGPEGSLVNSQSLKSIPEKFVVDKSTAGALDKKEGEQAKA
LFEKVKKFRLHVEEGDILYAMYVRQTVLKVIKFLIIIAYNSALVSKVQFTVDCNVDIQDM
TGYKNFSCNHTMAHLFSKLSFCYLCFVSIYGLTCLYTLYWLFYRSLREYSFEYVRQETGI
DDIPDVKNDFAFMLHMIDQYDPLYSKRFAVFLSEVSENKLKQLNLNNEWTPDKLRQKLQT
NTHNRLELPLIMLSGLPDTVFEITELQSLKLEIIKNVMIPATIAQLDNLQELSLHQCSVK
IHSAALSFLKENLKVLSVKFDDMRELPLWMYGLRNLEELYLVGSLSHDISKNVTLESLRD
LKSLKILSIKSNVSKIPQAVVDVSSHLQKMCIHNDGTKLVMLNNLKKMVNLTELELVHCD
LERIPHAVFSLLSLQELDLKENNLKSIEEIVSFQHLRKLTVLKLWYNSITYIPEHIKKLT
SLERLSFSHNKIEVLPSHLFLCNKIRYLDLSYNDIRFIPPEIGVLQSLQYFSITCNKVES
LPDELYFCKKLKTLKIGKNSLSVLSPKIGNLLFLSYLDVKGNHFEILPPELGDCRALKRA
GLVVEDALFETLPSDVREQMKTE
Download sequence
Identical sequences ENSPCAP00000011916 ENSPCAP00000011916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]