SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000012032 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000012032
Domain Number 1 Region: 212-418
Classification Level Classification E-value
Superfamily L domain-like 1.79e-41
Family Ngr ectodomain-like 0.00028
Further Details:      
 
Domain Number 2 Region: 1084-1274
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-41
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 50-181
Classification Level Classification E-value
Superfamily L domain-like 8.5e-28
Family Ngr ectodomain-like 0.0028
Further Details:      
 
Domain Number 4 Region: 748-826
Classification Level Classification E-value
Superfamily L domain-like 2.99e-20
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 5 Region: 446-508,556-611,743-805
Classification Level Classification E-value
Superfamily L domain-like 3.95e-20
Family Ngr ectodomain-like 0.00072
Further Details:      
 
Domain Number 6 Region: 946-1053
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000408
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 855-896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000839
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 8 Region: 1270-1311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000106
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000012032
Domain Number - Region: 1313-1348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0994
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000012032   Gene: ENSPCAG00000012734   Transcript: ENSPCAT00000012881
Sequence length 1468
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4036:6630:201937:1 gene:ENSPCAG00000012734 transcript:ENSPCAT00000012881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLNGNNITRITKTDFAGLRHLRVXXXXXXXXXXXXXXXXXXXXXXXXXRLNRNHLQLFPE
LLFLGTSKLYRLDLSENQIHAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVL
TLNNNNITRLSVASFNHMPKLRTXXXXXXHLYCDCHLAWLADWLRQRPRVGLYTQCMGPP
HLRGHNVAEVQKREFVCSGHQSFMAPSCSVLHCPAACACSNNIVDCRGKSLTEIPTNLPE
TITEIRLEQNSIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKI
TELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLR
AIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSA
KEQYFIPGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPDHIPQYTAELRL
NNNEFTVLEATGIFKKLPQLRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXMLRSNRITCLGNDSFVGLSSVRLLSLYDNQITTIAPGAFDTLHSLSTLN
LLANPFNCNCYLAWLGEWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISAV
PEGAFNDLSALSHLAIGANPLYCDCHMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTT
PSKKFTCQGPVDVSILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCSVPIHA
CISNPCKYGGTCHLKEGEKDGFXXXXXXXXXXXXXXXXXXXXXXNDCENNSTCVDGINNY
TCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKCILTPKGFKCDCTPGYVGEHCDIDFDDC
QDNKCKNGAHCTDAVNGYTCVCPEGYSGLFCEFAPPMVLPRTSPCDNFDCQNGAQCIIRI
NEPICQCLPGYQGEKCEKLVSVNFVNKESYLQIPSAKVRPQTNITLQIATDEDNGILLYK
GDRDHIAVELYRGRVRASYDTGSHPASAIYSVETINDGNFHIVELLALDQSLSLSVDGGS
PKIITNLSKQSTLNFDSPLYVGGMPGKNNVAAALRQAPGHNGTSFHGCLRNLYINSELQD
FRKVPMQTGILPGCEPCHKKVCAHGTCQPSSQSGFTCECEEGWMGPLCDQRTNDPCLGNN
CVHGTCLPINAFYSCCLEGHGGVLCDEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXISCRGERVRDYYQKQQGYAACQTTKKVSRLECRGGCAGGQCCGPLRSKRRK
YSFECTDGSSFVDEVEKAVKCGCTRCAS
Download sequence
Identical sequences ENSPCAP00000012032 ENSPCAP00000012032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]