SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000012067 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000012067
Domain Number 1 Region: 71-190,236-268
Classification Level Classification E-value
Superfamily L domain-like 1.02e-25
Family Ngr ectodomain-like 0.08
Further Details:      
 
Domain Number 2 Region: 611-666
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000292
Family Calponin-homology domain, CH-domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000012067   Gene: ENSPCAG00000012865   Transcript: ENSPCAT00000012918
Sequence length 761
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_3347:4651:215282:1 gene:ENSPCAG00000012865 transcript:ENSPCAT00000012918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPGSEPQPFVASLSGTTLHPHHHPHHHHHHGGAGTSGGAGGGGSSGGGGFNLPLNRGL
ERALEEAANSGGLNLSARKLKEFPRTAAPGHDLSDTVQADLSKNRLVEVPMELCHFVSLE
ILNLYHNCIRVIPEAIVNLQMLTYLNLSRNQLSTLPACLCGLPLKVLIASNNKLGSLPEE
IGQLKHLMELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLVDLPLVKFDFSCN
KVLVIPVCFREMKQLQVLLLENNPLQSPPAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXRPHLHQNVEDSKKDSDSGVGSDNGDKRLSATEPSDEDAVSLNVPMSNIMEEEQITKE
DICHRRSPLKGEFHQEFQPEPSLLANNDNSGEERDQFTEGTDVLSSGFMNYIKGRAEGCE
ELLRIEEDAHWPPERLVSSSNAQDVDIAMIEQLREAVDLLQDPNRLSMDITERSVVDLYP
MESAEALELQDTALNGQIQLEPSPVCEVQNDLTSQSNGSQYSPNEXXXXXXXVSPTTNNT
APFGLKPPLDPALTLPPISFNKLTQAQTWDSSSYSIPSEGDSDNVFLRPQRNLESIDPQF
TIRRKMEQMREEKELVEQLRESIEMRLKVSLHEDLGAALMDGVVLCHLVNHIRPRSVASI
HVPSPAVXXXXXXXXXXXXXXXXXXXXXXXXXXADLCSPYDILQLDFRHIRKTVDTLLAF
GEKPPQPTSALRSRDLVDLCLVPLFFVVLVYLTYRWNALSA
Download sequence
Identical sequences ENSPCAP00000012067 ENSPCAP00000012067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]