SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000012193 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000012193
Domain Number 1 Region: 346-646
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.01e-50
Family Rhodopsin-like 0.0013
Further Details:      
 
Domain Number 2 Region: 21-248
Classification Level Classification E-value
Superfamily L domain-like 2.21e-28
Family Ngr ectodomain-like 0.000000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000012193   Gene: ENSPCAG00000013058   Transcript: ENSPCAT00000013050
Sequence length 696
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5881:66259:153461:-1 gene:ENSPCAG00000013058 transcript:ENSPCAT00000013050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFLLVSLLAFLSLGSGCRHRLCHCSNRVFLCQESQVTAVPSDIPGNTVELXXXXXXXXX
XXXXXXXXXXXXXXXEISQNDVLEAIEADVFTNLLKLHEIRIEKANNLLHIDPEAFRNLP
NLRYLLISNTGIKHLPAVHKIQSLQKVLLDLQDNINLHTVERNSFMGLSFETVILWLNKN
GIQEVHSWAFNGTQLDELNLNDNSNLEELPNDVSGXXXXXXXXXXDISRTRIHSLPSYGL
ENLKKLRAQSTHNLKKLPSLEKFVALTEASLTYPSHCCAFANWRRQSTQLHPMCNKSSLR
QEVSVAQAKGQRVSVTEDDESSYGREFDVMYSELDYDLCNEVVDVTCYPKPDAFNPCEDI
MGYNILRILIWFISTLAITGNTIVLVILITSQYKLTVPRFLMCNLAFADFCIGVYLLLIA
SVDVHTKSQYYNYAIDWQTGAGCYAAGFFTVFASELSVYTLTAITLERWHTITHAMQLDC
KVQLRHAASVMLVGWIFAFTVALLPVFGISSYMKVSICLPMDIDSSLSRLYVMSLLVLNV
LAFVVICGCYTHIYLTVRNPNIVSSSSDTKIAKRMAMLIFTDFLCMAPISFFAISASLKV
PLITVSKSKILLVLFYPINSCANPFLYAIFTKTFRRDFFILMSKFGYYETQAQIYRTESS
CTAHNFHPRNAHCSPVPRVTRGPSYSLVPLSRLAKS
Download sequence
Identical sequences ENSPCAP00000012193 ENSPCAP00000012193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]