SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000012203 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000012203
Domain Number 1 Region: 1885-2080
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.88e-50
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 977-1170,1263-1305
Classification Level Classification E-value
Superfamily L domain-like 2.49e-26
Family Internalin LRR domain 0.02
Further Details:      
 
Domain Number 3 Region: 171-320,393-473
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000000699
Family HspBP1 domain 0.096
Further Details:      
 
Domain Number 4 Region: 2178-2290,2412-2461
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000285
Family WD40-repeat 0.019
Further Details:      
 
Domain Number 5 Region: 404-475,534-718,749-780
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000192
Family Plakophilin 1 helical region 0.081
Further Details:      
 
Domain Number 6 Region: 1334-1397
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000103
Family G proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000012203   Gene: ENSPCAG00000012894   Transcript: ENSPCAT00000013060
Sequence length 2528
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_7005:10083:153442:1 gene:ENSPCAG00000012894 transcript:ENSPCAT00000013060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGGCQRCVEDNEETLKKLIVRLNNVQEGKQIETLVQILEDMLVFTYADHASKLFQGKN
IHVPLLIVLDSYMRVACVQQVGWSLLCKLIEICPATMQSLMVPQDVGHDWEVLGVHQLIL
KMLTVHNANVNLSIVGLKALDLLLTSGKITLLILDEESDVFLLIFDAMRTFSANDEVQKL
GCKALHVLFERVSEEQLTEFIENRDYMVLLNTLKNFKDEEEIVLHILHCLHSLAVPCNNV
EVLMSGNVRCYNIVVEAMKAFPISEKIQEVSCCLLHRLTLGNFFNILVLNDVHEFVVKAV
QQYPENATLQISALSCLALLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFPAHREVMLSMLMHSSSKEVFQASA
NALSTLLEQNVNFRKILLSKGIYLNVLELMQRHAYSPEVAESGCKLLHHLFEGXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPEESRENTKSQHKLSIVQKQCFR
NDIHKLVLAALNRFIGNPGIQKCGLKVISSVAHFPDALEMLSLEGAVDSILHTLQMYPDD
QEIQCLGLSLIGCLIMKKNLSIGTGHLLAKLLVSSLQRFKDVAEVQMNGFQTVLAILNLS
VSFSKLLVHHSFDSVIFYQMSSSITEQKNQQLLNLCCKCFAKLAVDDELKNMMLERACDQ
NNSIMVECLLLLGADANQAKESTSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISI
GKGDSQIISLLLRRLALDLANNSICLGGFCMGKIEPSWLAPLFPDKTSNLRKQTNIGSTL
ARMVLRYQTKSSAKEETASGSDGNFPEDVLVKFDEWTFIPESSMDCVFGQSDDLDSEGSE
GSFLMKKKSNSIAVGEFYREPALQRCSPNLQRHSSSLGPVFDQEDLLKRRRKVVSLDDST
RSSKLQSHMRNSDSVSSLASEREHITSLDLSANELRDIDALSQKCCISGHLEHLEKLEFH
QNVLSSFPQQLCETLKCLTHLDLHSNKFTAFPSYLLEMNCIANLDISRNDIGPSVILDPT
VRCPTLKQFNLSYNQLSSVPENLAVVVEKLEQLILEGNKISGICYPLSLKELKILNLSKN
YISSLSEDFLEACPKVESFSARTNFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
IPPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELRLNFDFKHTGYKAKDII
RFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQGATVGIDVKDWHIP
VRGKRKKDLVLNVWDFAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXIRDQPVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKQLLYLVKE
NQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLFFVEPKWLCKVMAQILTVKVEGCP
KHPKGIISRRDVEKFLSKKRRFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPV
IELPHCENSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLINPDEPRLTIPISQIAPDL
VLADLPRNIMLNSDELEFEQAAEFLLGDGSFGSVYRAAYGGEEVAVKIFNKHTSLRLLRQ
ELVVLCHLHHPSLIFLLAAGIRPRMLVMELAPKGSLDRLLQQDKASLTRTLQHRIALHVA
DGLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFR
APEVAKGNVIYNQQADVYSFGLLLYDILTTGDRIVEGLKFPNEFDELAIQGKLPXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXVFDILNSAELVCLMRRILLPENFAVECMVATN
LNNKNVSIWLGYGHTEKGQLSFLDLNTEEHTSEEVTDSRILCLALVHLPVEKESWIVSGT
QSGTLLVINTEDRKKRHTLEKMTDAVTCLYCNSFSKQSKQKSFLLVGTADGNLAIFEDKA
VKCKGVAPLKILNIGNVSTPLMCLSESMNSAEKNIMWGGCGTKLFSFSNDFSIQKLIETK
TNQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEMLK
GNKESKHQMAYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRIIRIIHNFCDSIRVMM
TAQLGSLKHVMLVLGYNRKSTEGAQHQKEIQSCLSVWDINLPHEVQNLEKHIEMRKELAE
KMRGVPVE
Download sequence
Identical sequences ENSPCAP00000012203 ENSPCAP00000012203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]