SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000012257 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000012257
Domain Number 1 Region: 14-75
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-26
Family KRAB domain (Kruppel-associated box) 0.00085
Further Details:      
 
Domain Number 2 Region: 310-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 254-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 356-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.13e-21
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 159-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000108
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 6 Region: 206-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000157
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000012257   Gene: ENSPCAG00000013149   Transcript: ENSPCAT00000013117
Sequence length 432
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6365:699:20861:1 gene:ENSPCAG00000013149 transcript:ENSPCAT00000013117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKEMDDGTQIVRSQESVTFQDVAVDFTREEWDQLCPAQKNLYRDVMLENYRNLVAVGY
QLYKPEIITQLEQEEWWMMEGKSPLNTCPGGENRPKIKKSAQNQNISDEKQTHDMIMERL
TGDCVWFSILGELWNFDYQLELNQENQHKHLAQVSSTHRKITQEKIFECNKFGKNYNLNS
DLTVHQRIPSMKKLINSDTKRNNIKHNSDLIYYQENYVRENLYEYNESGKVFNQHLLLTH
HIHTAEKPSECGKTFSYSSSLTQPQIVLTGEKPYKCDECGKRFSQRIHLIQHQRIHTGEK
PFICNECGKAFRQHSSFTQHLRIHTGEKPYKCNQCGKAFSRITSLTEHYRLHTGEKPYEC
NFCGKAFSQRTHLNQHERTHTGEKPYKCNECGKAFSQSAHLNQHRKIHTREKLCEYNKCE
KALSHTPSFSSM
Download sequence
Identical sequences ENSPCAP00000012257 ENSPCAP00000012257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]