SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000012268 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000012268
Domain Number 1 Region: 115-246
Classification Level Classification E-value
Superfamily L domain-like 1.7e-32
Family Ngr ectodomain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 723-851
Classification Level Classification E-value
Superfamily L domain-like 8.17e-28
Family Ngr ectodomain-like 0.0028
Further Details:      
 
Domain Number 3 Region: 360-463
Classification Level Classification E-value
Superfamily L domain-like 1.12e-24
Family Ngr ectodomain-like 0.0013
Further Details:      
 
Domain Number 4 Region: 610-690
Classification Level Classification E-value
Superfamily L domain-like 2.1e-17
Family Ngr ectodomain-like 0.00049
Further Details:      
 
Domain Number 5 Region: 1230-1330
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-16
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 6 Region: 991-1025
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000089
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 276-332
Classification Level Classification E-value
Superfamily L domain-like 0.00000183
Family Ngr ectodomain-like 0.0064
Further Details:      
 
Domain Number 8 Region: 910-946
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000522
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 503-558
Classification Level Classification E-value
Superfamily L domain-like 0.00000936
Family Ngr ectodomain-like 0.0028
Further Details:      
 
Domain Number 10 Region: 1069-1104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000118
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 1414-1442
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000479
Family EGF-type module 0.016
Further Details:      
 
Domain Number 12 Region: 1366-1404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000569
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000012268
Domain Number - Region: 1332-1364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00177
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 977-993
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0839
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000012268   Gene: ENSPCAG00000012994   Transcript: ENSPCAT00000013129
Sequence length 1521
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6668:29001:430422:-1 gene:ENSPCAG00000012994 transcript:ENSPCAT00000013129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPRRTGTSAAVCARLVLALALASVLNGSPAAACPTKCTCSAASVDCHGLGLRAVPRGIP
RNAERLXXXXXXXXXXXXXXXXXXKLRVXXXXXXXXXXXXXXXXXXXXXXXXXRLNKNKL
QVLPELLFQSNAKLTRLDLSENQIQGIPRKAFRGIADVKNLQLDNNHISCIEDGAFRALR
DLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQFTL
CMAPVQLRGFSVADVQREYICSGPHSEPPSCNANSLSCPSACTCSNNIVDCRGKGLTEIP
TNLPEGIVEIRLEQNSIKSIPAGAFTQYKKLKRXXXXXXXXXXXXXXXXXXXXXXXXXVL
YGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGL
FAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDKPVETSGARCSSPRRLANKRISQIKSKK
LRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIVDCANQKLTRIPSHLPEYVTDLRLNDN
DISVLEATSIFKKLPNLRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXMLRSNLVSCVSNDTFAGLTSVRLLSLYDNRITTITPGAFTTLVSLSTINLLS
NPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNDESSCHLG
PRCPEQCTCVDTVVRCSNKGLRTLPKGIPKDVTELYLEGNHLTAVPRDLSALRHLTLIDL
SNNSIGVLTNYTFSNMSHLSTLILSYNRLRCIPTHAFNGLRSLRVXTLHGNDISSVPEGS
FNDLTSLSHLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXGPVDINVVAKCNACLSSPCKNNGTCSQDPVELYRCACPYGYKXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCVC
PPNYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCECLPGYSGKFCETDKDDCLAHK
CRHGAGCVDAVNGYTCTCPQGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXVETVNDGQFHSVELVMLNQTLNLVVDKGAPKSL
GKLQKQPAMGINSPLYLGGIPTSTGLSALRQGGDRPLGGFHGCIHEVRINNELQDFKALP
PQSLGVSPGCKSCSVCKHGLCRAVEKDSVVCECHPGWAGPLCDQEAWDPCLGHSCSHGRC
VAAGTSYTCICAEGYGGALCDYRNDSTNACTALKCRHGQCHVSEQGEPHCLCQPGFSGEH
CEQEKPCQGEVVREVIHRQKGYASCTTASKVPIMECRGGCGPQCCQPIRSKRRKYVFQCT
DGSSFVEEVERHLDCGCRLCS
Download sequence
Identical sequences ENSPCAP00000012268 ENSPCAP00000012268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]