SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000012402 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000012402
Domain Number 1 Region: 42-321
Classification Level Classification E-value
Superfamily L domain-like 2.49e-54
Family Ngr ectodomain-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000012402   Gene: ENSPCAG00000013298   Transcript: ENSPCAT00000013273
Sequence length 517
Comment pep:known_by_projection scaffold:proCap1:scaffold_5717:35525:37204:1 gene:ENSPCAG00000013298 transcript:ENSPCAT00000013273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLLLGLCLYWLLRRPSGVVLCLLGACFQMLPAAPSGCPQLCRCEGRLLYCEALNLTEA
PLNLSGLLGLSLRYNSLSELRAGQFTGLMQLTWLYLDHNHICSVQGDAFQKLRRVKELTL
SSNQITQLANTTFRPMPNLRSVDLSYNKLQALAPDLFHGLRKLTTLHMRSNAIQFVPVRI
FQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNHLVKVNFAHFPRLISLHSLCL
RRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVPHLQSLQLDSNRLTYVEPRIL
NSWKSLTSITLAGNLWDCGRNVCAVSWLSNFHGRYDGSLQCASPEYAQGEDVLDAVYAFH
LCEDGAEPTSDHLLSAVTNHSDQGPSASLTLAGGREGQDGTLEATVALPGSEHAENAVQI
HKVVTGTMALIFSILIVVLMLYVSWKCLPASLRQLRQCFVTQRRKQKQKQTMHQMAAMSA
QEYYVDYKPNHIEGALVIINEYGSCTCHQQPARECEV
Download sequence
Identical sequences ENSPCAP00000012402 ENSPCAP00000012402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]