SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000012409 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000012409
Domain Number 1 Region: 280-523,550-627
Classification Level Classification E-value
Superfamily L domain-like 2.55e-41
Family Leucine rich effector protein YopM 0.037
Further Details:      
 
Domain Number 2 Region: 58-233
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000373
Family Ankyrin repeat 0.003
Further Details:      
 
Domain Number 3 Region: 651-838
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000156
Family G proteins 0.0096
Further Details:      
 
Domain Number 4 Region: 1257-1361
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000302
Family Protein kinases, catalytic subunit 0.0041
Further Details:      
 
Domain Number 5 Region: 1553-1798
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000549
Family WD40-repeat 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000012409   Gene: ENSPCAG00000013161   Transcript: ENSPCAT00000013280
Sequence length 2027
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6662:124055:264664:1 gene:ENSPCAG00000013161 transcript:ENSPCAT00000013280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGMSRRLPSMYWCVGPEGSAMCPARTMETHNGAGGMGSKLSTPGSDCVAPSPWTEDIHT
AYKQGNPTKARDLIREACDESTPQLEKGQLLSISAAYGDLEMVRYLLTERRTELSTEPTD
DNPAVVAARFGHTTIVQELLESKPTECDRVPFLSCRPPAGPCSPQRLLNWMLALACQRGH
LEVVKLLVLTHGANPESCAVRKNEFPAIVRLPLYAAIKSGNEDIAIFMLRHGAFFCSYIL
LDSPDPSKHLLRKYFMEASALPSGCPGKVALRVKWSHLRLPWVDLDWLIDISCQITELDL
SANCLASLPSVIPWGLINLRKLNLADNHLGELPGVQSSDEIICSRLLEIDISGNKLFHLP
PGFLHLSKLQKLTASKNYLEKLFEEENATNWIGLRKLQELDVSDNKLTELPALFLHSFKS
LSCLNVSRNNLKAFPDPWACPLKCCKASRNALESLPDKMALFWKNHLKDVDFSENSLKEV
PLGLFQLDALMFLRLQGNQLEALPPQDKWTCRQLKTLDLSRNQLGKSEDGLKTKRISFFT
TRGRQRSGTETGCVLEFPAFLSESLEVLCLNDNHLDAVPPSVCLLKSLSELYLGNNPGLR
ELPQELGQLGNLWQLDVEDLRISNVPAEIQKEGPKATLSYLRAQLRKAERCKLMKMIIVG
PPRQGKSTLLEILQTGRAPQMVHGEATIRTSKWELQRPAGSKAKVESVEFNVWDIGGPAS
MATVNQCFFTDKALYVVVWNLALGEEAVASLQFWLLSIEAKAPNAVVLVVGTHLDLIETK
FRVERIATLRAYVLALCRSPSGARATGFPDITNKHLHELSCKSLEGQEGLRQLIFHVTCS
MKDVGSTIGCQRLAGRLVPKSYLSLQEAVLAEQQRRRQTDTVQYLTDRQLEQLVEQTPEN
DVKDYEDLQAAISLIETGTLLHFPDTSHGRNLYFLDPIWLAECLQRIFNIKASRSVAKNG
VIRTEDLRMLLVGTGFTQQTEEQYFQFLAKFEIALPVANDSYLLPHLLPSKPGLDTHGTR
HPTANTIKRVFKMSFVPVGFWQRFIARMLISLAEMDLQLFENKKNTKSRSRRVTIYSFTG
NQRNRCSTFRVKRNHTIYWQEGLLVTFDGGDLSVESSDINWKKKKSGGIKIICQSEMRDF
SAMAFITDHVNCLIDQWFPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLFLENSKLEHSEDDSSI
LGQGGSGTVIYRARYQGQPVAVKRFQIKKFKNFANAPATMLRHLRATDAMKNFSEFRQEA
SMLHALQHPCIVSLIGISIHPLGFALELAPLGSLNTVLSENAKXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXRPLALSVVSQMKDPTFAAFMYMLPCGKQTSFFSSQGQEY
TVVFWDGKEETRNYTVVNTEKGLLEVQRMSCAGMRLSCQLKVQSSLWTATEDQKIDIYSL
KGMCPLNTPQRALDTPAVVTCFLAVPVIKKNSYLILAGLSDGLVAVFPVTRGAPDDSCCY
LCSHTANRSKFGIPDEDTRQNPYPVKAMEVVNSGSEVWYSNGPGLLVINCSALEICQRLE
PYCNPSIVTSIVCSSECRGEEVVWCLDDKANSLVMYHSATYQLCARYFCGDPNPLRDVFP
VCPAGLEPPDSPATGPQEMEGDGLADVSIIYSKELGTQILAHQDSLTDYCSMSSYSSSPP
CRAARSLASLPTSPASSSSVPFSSTDYETSDRLHXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXRGGDIIVIGLEKESGAQRGRVIAVLKARELNPHGALVDAATVAKD
TVVCGFANESSEWCLAVWRGWGAREFDIFYQSYEELGRLETYTRKRR
Download sequence
Identical sequences ENSPCAP00000012409 ENSPCAP00000012409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]