SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000012527 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000012527
Domain Number 1 Region: 4-197
Classification Level Classification E-value
Superfamily L domain-like 5.17e-29
Family Leucine rich effector protein YopM 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000012527   Gene: ENSPCAG00000013451   Transcript: ENSPCAT00000013406
Sequence length 241
Comment pep:known_by_projection scaffold:proCap1:scaffold_1534:101212:101961:-1 gene:ENSPCAG00000013451 transcript:ENSPCAT00000013406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQQLELSGRRLRRLPSAVCALSRLQKLYVSGTGLRELPEEIEELRELRILALDFNKLERL
PDGLCRLPRLTRLYLGSNRLLSLPADFAQLQSRCLWIEGNFLRXXXXXXXXXXXXXXXXX
XXXXXXXXXAELPRMTGLRGLWLYGNRFEEFPPALLRMGRLHILDLDRNRLGGFPDLHPL
RALRVFSYDHNPVTGPPRVADTVFLVGEGAVERMAERDEPTPRPQPRRPARAFEDEEEED
L
Download sequence
Identical sequences ENSPCAP00000012527 ENSPCAP00000012527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]