SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000012679 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000012679
Domain Number 1 Region: 91-124
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000034
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000012679   Gene: ENSPCAG00000013552   Transcript: ENSPCAT00000013567
Sequence length 503
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_207:987:43263:-1 gene:ENSPCAG00000013552 transcript:ENSPCAT00000013567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMPHSLESNAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYRHAYLLQP
SQFHGELCSFSDKETEDCVTNRPCRSQVRCEGFLCAHTGRCINRRLLCNGDNDCGDQLDE
ANCRRTYKKCQHEVDRYWAIDTLASGLNLFTSSLEGPVLDHRYYGGGCSPHYILNTRFRK
PHNVESYTPKTQGKYEFVLTKYESYADFERNITERTAGMSTSSFGFKIQSFGTMTRSANA
KHFISRIKRFAHTXXXXXXXXXXXXXXXXXXXPRSLMLHYEFLQRVRRLPLEYSYGEYRE
LFRDYGTHYITEAVLGGTYEYTLVIDQEALERADVSLSDVQECAKHGFKFQVSIKIVSLK
VGVSTNLCDAILNEIEDRNKRQTAVHDLVVRVRGGTSEHITALAYKQLPTAELMQEWGDA
VQYNPSIIKIEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXSRERICPIGFRGSGEVTSRN
Download sequence
Identical sequences ENSPCAP00000012679 ENSPCAP00000012679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]