SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000012964 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000012964
Domain Number 1 Region: 4-131
Classification Level Classification E-value
Superfamily L domain-like 2.86e-30
Family Ngr ectodomain-like 0.0045
Further Details:      
 
Domain Number 2 Region: 2209-2301
Classification Level Classification E-value
Superfamily Immunoglobulin 8.44e-21
Family I set domains 0.024
Further Details:      
 
Domain Number 3 Region: 2401-2494
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-20
Family I set domains 0.021
Further Details:      
 
Domain Number 4 Region: 1817-1911
Classification Level Classification E-value
Superfamily Immunoglobulin 8.69e-20
Family I set domains 0.043
Further Details:      
 
Domain Number 5 Region: 1714-1807
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-19
Family I set domains 0.0085
Further Details:      
 
Domain Number 6 Region: 1907-2001
Classification Level Classification E-value
Superfamily Immunoglobulin 7.92e-19
Family I set domains 0.017
Further Details:      
 
Domain Number 7 Region: 2104-2208
Classification Level Classification E-value
Superfamily Immunoglobulin 6.35e-16
Family I set domains 0.048
Further Details:      
 
Domain Number 8 Region: 480-562
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000388
Family I set domains 0.021
Further Details:      
 
Domain Number 9 Region: 381-471
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000139
Family V set domains (antibody variable domain-like) 0.08
Further Details:      
 
Domain Number 10 Region: 2318-2396
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000267
Family I set domains 0.041
Further Details:      
 
Domain Number 11 Region: 2507-2594
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000175
Family I set domains 0.037
Further Details:      
 
Domain Number 12 Region: 2566-2645
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000159
Family I set domains 0.074
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000012964
Domain Number - Region: 2009-2049
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000928
Family I set domains 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000012964   Gene: ENSPCAG00000013828   Transcript: ENSPCAT00000013870
Sequence length 2647
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_1335:3:15911:-1 gene:ENSPCAG00000013828 transcript:ENSPCAT00000013870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFKFSYNKLRVLTAQTLQGLSSLVRLHVDHNRIEFIHPHAFHGLTSLRLLHLEGNALQQL
HAAAFATFSFLDHFPLSTVRHLYLAENGLSSLPPGMLPNMPLLETLYLHGNPWACGCEMK
WFLQWEARSRGILKCKKDKAYEGGQLCATCFSPKKLQKQEQKLQDVACSKPLIESPLRQN
RSASSEEEQGVEEEDGSLSLHSFHLPTWNVSLNMTDEHGNTVDLVCSIEKPTDVYKLFLN
QTDPLEIEVNATVALDLDCPMTRESYERFWKLIAYYSEVPLKLHREATLGQDPGAHCEYR
QDADDDALYYTGVRARILAEPSWVMQPSVHLQLNRRHSTAKKVLLNYYAQFVQTLSTKDV
KRAQSRSGSWVMLEPSGAVQRTQTVLEGSSFQLTCNVRASESPTIFWVLPDGSVLKGPVE
DSTSKFSILSGGQLRVKSVGYSDSGLYQCVARVTDEMDHMVYRVSVQAPVAPPHGGHTVT
VTKSPGEALVLPCGALSVPEAELSWVLPSKRIVNHLANTSHVYVLDNGTLHIPQVQASDG
GYYRCVATNLQGTDHFTVGVTVNKKGHGRTSKRGPGTKPLSRRRGDVVEDEGGSGIGAEE
NAPARVRHPVDHEVFIQTKDEARVRGPQTKKGRRKLKPWKNPEEEAEMNIAEGRRLESRR
RVHTANKQINPERWADILARVRERNPLKGTEVPPRSKTTTPPSVGTEVSPLSPAVPPPSV
SPVGPTGRVEESSAPPPCEEEQGWGTTSSPRMVLAGDGNGVVLTEPRVTSLQLEEVPDHE
ISEKTEDPTPPEAHSSVSALMSVPDSSSSPLQVLDTFYEEPSYKEEATEGSSTAPSIESV
PPLTSRVEDAISLVASEPKYFFPEPETDSQPVEGKMEEGTSTDFTPTPTWWACYPRTSEP
LGEPDGPTQTHPQGHEDNLWLVKGDSGTQGDSLMKKDTAEKSQIPGERNALERDPAGSQR
PEREGQDTVSASPFQPATETTPDTLLGRDTVTTSGVTSAPKTTWPTELTTHPSRRKPHGR
KRLRPHRQRHRHKQGPPATAAPGQTLSPQPTQVSDTKGPSKPEGLLVVSPGAGDTAGVPK
QLEMGKAAEAVTRGTPRRKHSKKPNKHRHGTSVGTSTDSLAKTTSAPDSKPKHTVTPSSE
TPLFSATMPLQTGDPHETRRAADDSTTTSKASPALSQGQGTAAVTHRPASDGEEITGHRV
SNVPDDTGSLPAPTESETDILPPSGSEVSPVEGSHPSGLPGIAHWTSPGMAQPWKVETGS
PEGRSWATRTEPPHREELESPDFPSEVSPLGATAAVSQQGEGEASATTSRIGLELPSGQA
EATARGQDQQKPTPVTTHPEVRPQDHVPTPGSPERTEPPLSPTTLMPSVQTTVQSPSLIP
ETSQTPTESKENILFNYAGVSENREPQLNHEGTQSLRKLDEPSTPSSKQDNVDFSPQDAL
EGQTPNTPPGGPDTHHQDRRVQILQQPDIVPTRPTAPRGTGRPPVATQSSYRHMVTFQPP
RQVTSSKPEIRVYASRDFPERKPLETPKLATTAPALLHRPKPSIPGTFGDHGTNQFNANA
RVFANNNIPDPRRPAARLPSSRLPHHSDGRFPFFFNRTFTFSQIGATLRPQTPTAPAPVT
RERKVHPGSHNRILSQSVIHMDLGPPAPPRPHLPRSPAPPSPNAHNIPPVHATRSPVPSV
RSSGLPSRNVHQSSSKLFPTGGLPASQFWTPGEKPQIITKSPQTLFVTAETDAVFPCEAT
GKPTPFITWTNVSTGALLTPNTRRQRSEVLKNGTLVIHRAQVQDQGQYLCTAKNLHGLDT
MPVLLKVTTQEPQSPATHYQDVTVYLGDTIAMECLAKGTPAPRISWIFPDGRVWHTVSAV
EGRVTLHENRTLSIKEASFSDRGVYKCVASNAAGADSLAIRLHVAALPPVIHQEKLENIS
LPPGLGVHIHCTAQAAPPPAVRWVLGDGTQVRPSQFVRGNLFVFPNGTLYIRHLSPRDSG
RYECVAANAVGSARRTVRLAVQRAAANARITGTSPRRTDVRYGGTLRLDCRAAGDPWPRT
QWRLPSLRVVDALSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVARNKVGDDYVVLRVNV
LMRPAKIKHKENEHQVFYGGHLKVDCVATGLPNPEISWSLPDGSLVNPFMLSDDSGGRAK
RYVVFNNGTLYFNEVGMREEGHYTCFAENQVGKDEMTVRVKVVAEPPAIRNKTYSIIQVP
YGDVVTVTCEAKGEPTPKVTWLSPTNRLIPASSDKYRVYQDGTLLIQKAQRSDSGNYTCV
VRNSAGEDRKVVWIQVRVQPPKINGNRNAITTVREVAPGGSRKLIDCRAQGIPAPRALWA
FPEGMLLPAPYYGNRITVHRNGTLDIHSLRKSDSVQFVCIARNEGGEARLIVQLTVLDPV
EKPVFHDPVSEKITATAGHTISLNCSATGTPVPTLAWVLPNGTELPSSRRLQRFYHKADG
RLYISDLSSADAGAYRCVARNSAGYSERLVSLKVGLKPGASGPYQNVVTIVHGEALHLPC
PVPAGRPARVSWTLPSGLVMEVPQEAGRFALLENGTLTVREASVFDRGTYTCQADTGHSP
SVTSFPVIIIAYPPRITSEATPVIYTRPGSTVKMNCLAVGLPKAQITWELPDKSQLTAGT
QTRILGN
Download sequence
Identical sequences ENSPCAP00000012964 ENSPCAP00000012964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]