SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000013087 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000013087
Domain Number 1 Region: 571-635
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000208
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 2 Region: 500-546
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000034
Family TSP-1 type 1 repeat 0.00063
Further Details:      
 
Domain Number 3 Region: 627-683
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000032
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 4 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000011
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 78-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000166
Family LDL receptor-like module 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000013087
Domain Number - Region: 452-490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0193
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000013087   Gene: ENSPCAG00000013953   Transcript: ENSPCAT00000014004
Sequence length 843
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2017:5240:87692:1 gene:ENSPCAG00000013953 transcript:ENSPCAT00000014004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALSLFILVGFAGELQLFLSASSPVNCQWDAYAPWSECNGCTKTQTRRRSVAVYGQYGG
LPCAGSAFETQSCEPTRGCPTEEGCGERFRCFSGQCISRSLVCNGDSDCEEDSSDEDRCE
GSENRPACDIDKPPPNVELTGNGYNALTGQFRKTVINTKSFGGQCRKVFSGDGKDFYRLS
GNVLSYTFQVKVNNDFNYEFYNSSWSYIKETSTIYTSSQKKKSFFRSSSSHSHSHTYNKD
ESHMKKSYQLMVIQNTVEVAQFINNNPDFLHLAEPFWRELSHLPSVYDYSAYRRLIDQFG
THYLQSGSLGGEYRVLFYVDSEKITEKGFTTADMKECSSSGFGFFIVQSSSSKCKNLEDA
LKAASGTQNNMLRGDPFVRGGSSAFVAGLNFLEVDNPVGNKKRYSTWAGSVTDLPVVVKQ
KLTPLYELVKEVPCASVKRLYLKRALEEYVDEFDPCHCQPCQNGGMATVDGTQCQCHCKP
YTFGVACEQGVLVGNQAGGVDGGWSCWSPWGPCVQGKKTRTRECNNPPPSEGGQSCLGET
SESQQCKEEELEHFRSLEPHCFPLSLVPTRFCPSPPALKDGFVQTEDAMFPVGKNIVYTC
NEGYALIGDPVARCGEDLKWLVGQMRCQKIACVLPASMNGMQSHPRKSFYEVGEKVTFSC
PGGMSLEGPSVFLCGSSLKWSPEVQSAQCVQKXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
GNCDAQRNRCVCREASECEEEGFTVCVEVNGQEQTMTECQAGALRCRGRSVTITSITPCA
ARE
Download sequence
Identical sequences ENSPCAP00000013087 ENSPCAP00000013087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]