SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000013230 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000013230
Domain Number 1 Region: 264-483
Classification Level Classification E-value
Superfamily L domain-like 5.67e-42
Family Ngr ectodomain-like 0.0015
Further Details:      
 
Domain Number 2 Region: 48-226
Classification Level Classification E-value
Superfamily L domain-like 9.78e-34
Family Ngr ectodomain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000013230   Gene: ENSPCAG00000014160   Transcript: ENSPCAT00000014160
Sequence length 502
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_3049:129538:134200:-1 gene:ENSPCAG00000014160 transcript:ENSPCAT00000014160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTELGPAMRLILLLLFLMWPGLRVAPIMEDAAFPHLGESSQPLPQPCPSRCSCPRVDTVD
CAGLDLRVFPDNITRAAQYLSLQNNQLQELPYNELSRLSGLRTLNLHNNLISSEGLPDEA
FESLTQLQHIYVAHNKLSVAPQFLPRSLRVADLAANQMTEIFPLTFGEKPALRSVYLHNN
QLSNAGLPADAFRGSEAVATLSLSSNRLSYLPPSLPPSLERLHLQXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXKLYSLEYLDLSHNQLAEVPAGLPQALAILHLGRNCI
RRVEGARLQGARGLRYLLLQHNALGSTGLPPGALRPLRRLHTLHLYGNGLDRVPLQLPRR
LRALVLPHNEVASLGARDLASMRSLAELNLAYNRLVSARIHHRAFRPLRALRSLDLAGNQ
LTRLPTGLPTSLHTLRLQRNQLRALEPEPLAGLDQLEELSLAHNRLRVGDIGPGTWHELQ
ALKVRGRNTVHKAPHLLRPHSS
Download sequence
Identical sequences ENSPCAP00000013230 ENSPCAP00000013230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]