SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000013302 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000013302
Domain Number 1 Region: 26-262
Classification Level Classification E-value
Superfamily L domain-like 9.35e-44
Family Ngr ectodomain-like 0.0008
Further Details:      
 
Domain Number 2 Region: 263-367
Classification Level Classification E-value
Superfamily Immunoglobulin 1.87e-16
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000013302   Gene: ENSPCAG00000014283   Transcript: ENSPCAT00000014237
Sequence length 521
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5613:30843:33384:-1 gene:ENSPCAG00000014283 transcript:ENSPCAT00000014237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGVPTLLLLLLLPSPLPGLPPRAASCPAACRCYSATVECGALRLRTVPPGIPPGTQTL
FLQDNSIVRLEPGVLAPLATLRHLYLHNNSLRALESDVFRAQSRLLELALNGNRLRGLQG
GAFAGLTQLRVLYLAGNQLAQLLDFTFLHLPRLQELHLQENSIELLEDQALAGLSSLALL
DLSRNQLGTISRESLRPLASLQVLRLTENPWRCDCALHWLGTWIKEGGQRLLSSMDKKIM
CAEPPRLALQSLLDVSGSSLICIPPSVHVDPLEITANLGEDLRVACQASGYPQPLVTWRK
VSQPREGAPQAQARAEGGAPGLGGHGAPDTGSGMLFLTNITLAHAGKYECEASNAGGAAR
MPFQLLVNLSQQQRLPAAPPPPPAGPVSHEPLYEAGSMAFRALGLATQTAIAAGIALLAL
TALLLAAMICRKRRKRNKEAGPPGESVLFINDYSDGPCTFAQLEELRDERGHEMFVIDRS
KLFAEGPVAEARPDRAHAEGAAHGPAPALQLPPPVSYEIHC
Download sequence
Identical sequences ENSPCAP00000013302 ENSPCAP00000013302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]