SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000013458 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000013458
Domain Number 1 Region: 45-337
Classification Level Classification E-value
Superfamily L domain-like 4.22e-45
Family Ngr ectodomain-like 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000013458   Gene: ENSPCAG00000014445   Transcript: ENSPCAT00000014402
Sequence length 350
Comment pep:known_by_projection scaffold:proCap1:scaffold_48484:7323:12542:-1 gene:ENSPCAG00000014445 transcript:ENSPCAT00000014402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTVCFLVWVWLVTDTVWTRSARQVPVMNEPDDWTVGDFDCPRECFCPPSFPTALYCEN
RGLKEIPAIPSRIRYLYLENNLIETIPEKPFENATQLRWINLNKNKITNYGIEKGALSQL
KKLLFLFLEDNELEEVPSPLPRSLEQLQLARNKVSRIPQGTFSNLENLTLLDLQHNKLLD
NAFQRDTFKGLKNLMQLNMAKNSLKNMPPRLPANTMQLFLDNNSIEGIPENYFNVIPKVA
FLRLNHNKLSDAGLPSNGFDVSSILDLQLSHNLLTKVPRINAHLQHLHLDHNKIKSVNVS
VICRLSALEEHDFFSYGPRLSYIRLDGNDIKPPIPMDLMTCFRLLQAVII
Download sequence
Identical sequences ENSPCAP00000013458 ENSPCAP00000013458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]