SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000013518 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000013518
Domain Number 1 Region: 1267-1532
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-52
Family YWTD domain 0.00000192
Further Details:      
 
Domain Number 2 Region: 3026-3283
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-52
Family YWTD domain 0.00000215
Further Details:      
 
Domain Number 3 Region: 1889-2149
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-45
Family YWTD domain 0.0000123
Further Details:      
 
Domain Number 4 Region: 3869-4140
Classification Level Classification E-value
Superfamily YWTD domain 9.16e-44
Family YWTD domain 0.00000547
Further Details:      
 
Domain Number 5 Region: 1582-1839
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-43
Family YWTD domain 0.0000189
Further Details:      
 
Domain Number 6 Region: 534-773
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-41
Family YWTD domain 0.00000905
Further Details:      
 
Domain Number 7 Region: 200-467
Classification Level Classification E-value
Superfamily YWTD domain 1.22e-38
Family YWTD domain 0.00012
Further Details:      
 
Domain Number 8 Region: 2198-2467
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-34
Family YWTD domain 0.0000355
Further Details:      
 
Domain Number 9 Region: 2914-3018,3276-3337
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.51e-21
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 1180-1259,1525-1577
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000479
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 11 Region: 846-888
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000055
Family LDL receptor-like module 0.0000883
Further Details:      
 
Domain Number 12 Region: 3565-3606
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000851
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 13 Region: 23-61
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 14 Region: 927-966
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 15 Region: 3365-3409
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 16 Region: 3648-3693
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 17 Region: 1011-1048
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0000983
Further Details:      
 
Domain Number 18 Region: 887-929
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 19 Region: 2690-2727
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 20 Region: 3484-3523
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 21 Region: 972-1009
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 22 Region: 3527-3566
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 23 Region: 1055-1095
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 24 Region: 2557-2597
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 25 Region: 2812-2847
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 26 Region: 2730-2764
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 27 Region: 118-190,475-517
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000487
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 28 Region: 3447-3482
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 29 Region: 2597-2636
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 30 Region: 2849-2889
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000929
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 31 Region: 3407-3445
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000109
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 32 Region: 3328-3363
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 33 Region: 2770-2804
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 34 Region: 3735-3771
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 35 Region: 1842-1893
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000105
Family EGF-type module 0.012
Further Details:      
 
Domain Number 36 Region: 2521-2558
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000118
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 37 Region: 800-845
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000255
Family EGF-type module 0.041
Further Details:      
 
Domain Number 38 Region: 3607-3642
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000576
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 39 Region: 1104-1138
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000694
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 40 Region: 1141-1176
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000124
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 41 Region: 2656-2686
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000131
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 42 Region: 2152-2199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000587
Family EGF-type module 0.012
Further Details:      
 
Domain Number 43 Region: 3690-3726
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000236
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 44 Region: 3819-3855
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000805
Family EGF-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000013518
Domain Number - Region: 4192-4227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000104
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 4229-4266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000303
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 3780-3826
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000308
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 4265-4300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000712
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 4369-4410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 2476-2536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0082
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 4303-4336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 4148-4180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0991
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000013518   Gene: ENSPCAG00000014030   Transcript: ENSPCAT00000014467
Sequence length 4539
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2620:7086:91030:1 gene:ENSPCAG00000014030 transcript:ENSPCAT00000014467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTPPWLLLLPLLSALVAAAIDVPKTCSPKQFACRDQITCISKGWRCDGEKDCPDGSDEA
SEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRVNCSRRGC
QHHCVPTLAGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFTCGCVEGYL
LQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANE
TVCWVHVGDSAAQTQLKCARMPGLGFVDEHTINISLLHHVEQMAIDWLTGNFYFVDDIDD
RIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTKLV
DSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFENY
LYATNSDNANAQQKTSVIRVNRFNSTEYQVVTRVDKGGALHIYHQRRQPRVRSHACENDQ
YGKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRGMD
MGAKVPDEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDGIH
NVEGVAVDWMGDNLYWTDDGPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNGWM
YWTDWEEDPKDSRRGRLERAWMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFYDR
IETILLNGTDRKIVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLERGTGGTPPTVTLL
RSERPPIFEIRMYDAQQQQVGTNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDADGVTC
LANPSYVPPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRFKC
ENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDDCG
DRSDESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQFKC
NSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTDEFQCRLDGLCIPLRWRC
DGDTDCMDSSDEKSCEGVTHVCDPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEENCES
LACRPPSHPCANNTSVCLPPDKLCDGNDDCGDSSDEGELCDQCSLNNGGCSHNCSVAPGE
GIVCSCPLGMELGPDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGESCR
SLDPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDKIY
RGKLLDNGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTTLL
AGDIEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRTIHRETGSGGWPNGLTVD
YLEKRILWIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNTLA
KANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPMAPNPCEANGGRGPCSHLCLINYNRTVS
CACPHLMKLHEDNTTCYEFKKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVLDY
DAREQRVYWSDVRTQAIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDTNKK
QINVARLDGSFKNAVVQGLEQPHSLVVHPLRGKLYWTDGDNISMANMDGSNRTLLFSSQK
GPVGLAIDFPENKLYWISSRNHTINRCNLDGSGLEVITAMWSQLGKATALAIMGDKLWWA
DQVSEKMGTCNKADGSGSVVLRNSTTLVMHMKVYDESTQLHEGTNPCSVNNGDCSQLCLP
TSETTRSCMCTAGYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPSDKSDALVPVSGTSL
AVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNIYWTD
QGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGQYPRIERSRLDGTER
VVLVNVSISWPNGISVDYEGGKLYWCDARTDKIERIDLETGENREVVLSSNNMDMFSVSV
FEEFIYWSDRTHANGSIKRGSKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCAVAN
GGCQQLCLYRGGGQRACACAHGMLAEDGATCREYAGYLLYSERTILKSIHLSDERNLNAP
VQPFEDPEHMKNVIALAFDYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSGRITIVENVG
SVEGLAYHRGWDTLYWTSYTTSTITRHTVDQTRPGAFERETVITMSGDDHPRAFVLDECQ
NLMFWTNWNEQHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDKIER
CEYDGSHRYVILKSEPVHPFGLAVYGEHIFWTDWVRRAVQRANKYVGSDMKLLRVDIPQQ
PMGIIAVANDTNSCELSPCRINNGGCQDLCLLTHQGHVNCSCRGGRVLQEDFTCRAVNSS
CRAQDEFECANGECINFSLTCDGVSHCKDKSDEKPSYCNSRRCKKTFRQCSNGRCVSNML
WCNGADDCGDGSDEIPCNKTACSVGEFRCRDGTCIGNSSRCNQFVDCEDASDEMNCSATD
CSSYFRLGVKGVLFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGMKRPRCPLNYFAC
PSGRCIPMSWTCDKEDDCEHGEDEARCNKFCSEAQFECQNHRCISKQWLCDGSDDCGDGS
DEAAHCEGKTCGPSSFSCPDTHVCVPERWLCDGDKDCADGADESVAAGCLYNSTCDGREF
MCQNRQCIPKHFVCDHDRDCTDGSDESTECEYPTCGPNEFRCANGRCLSSRQWECDGEND
CHDQSDEAPKNPHCTSSEHKCNASSQFLCSSGRCVAEVLLCNGQDDCGDGSDERGCHVNE
CLSRKLSGCSQDCEDLKIGFKCRCRPGFRLKDDGRTCADVDECTTTFPCSQRCINTHGSY
KCLCVEGYAPRGDHPHSCKAVTDEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAVALD
FDYREQMIYWTDVTTQGSMIRRMHLNGSNVQVLHRTGLSNPDGLAVDWVGGNLYWCDKGR
DTIEVSKLNGAYRTVLVSSGLSEPRALVVDVQNGYLWTEWVDHFLIGRIGMDGSSRSVIV
DTKITWPNGLTLDYVTERIYWADAREDYIEFASLDGSNRHVVLSQDIPHIFALTLFEDYV
YWTDWETKSINRAHKTTGANKTLLISTLHRPMDLHVFHALRQPDVPNHPCKVNNGGCSNL
CLLSPRGGHKCACPTNFYLGSDGRTCVSNCTASQFVCKNDKCIPFWWKCDTEDDCGDHSD
EPPDCPEFKCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKCTNTN
RCIPGIFRCNGQDNCGDGEDERDCPEVTCAPNQFQCSITKRCIPRVWVCDRDNDCVDGSD
EPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECDERTCEPYQFRCK
NNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSCANGRCIAGRWKCDGDHDCADGS
DEKDCTLRCDMDQFQCKSGHCILRWRCDADADCMDGSDEEACGTGVRTCPLDEFQCNNTL
CKPLAWKCDGEDDCGDNSDENPEECSRFLCPPNRPFRCKNDRVCLWIGRQCDGTDNCGDG
TDEEDCESPTAQIPHCKDKKEFLCRNQRCLSSSLRCNMFDDCGDGSDEEGCSIDSKLTSC
AANTSICGDEARCIRTEKAAYCSCCPGLHTVPGQPGCQDINECLRFGTCSQLCNNTKGSH
LCSCARNFMKTHNTCKAEGSEYQVLYIADDNEIRSLFPGHPHSAYEQAFQGDETVRIDAM
DVHVKAGRVYWTNWHTGTISYRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKMPRGIAI
DWVAGNVYWTDSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDWGNHPK
IETAAMDGTLRETLVQDNIQWPTGLAVDYHNERLYWADAKLSVIGSIRLNGTDPIVAADS
KRGLSHPFSIDVFEDYIYGVTYINNRVFKIHKFGHSPLVNLTGGLSHASDVVLYHQHKQP
EVTNPCDRKKCEWLCLLSPSGPVCTCPNGKRLDNGTCVAVPSPTPSPDAPRPGTCNLQCF
NGGSCFLNARRQPKCRCQPRYTGDKCELDQCWEYCRNGGTCAASPSGMPTCRCPTGFTGP
KCTQQVCAGYCANNSTCAVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQMAADGS
RQCRCTAYFEGPRCEVNKCSRCLEGTCVVNKQSGDVTCNCSDGRVAPSCLTCDGHCSNGG
SCTMNNKMMPECQCPPHMTGPRCEEQVVNQQQSGHMASILIPLLLLLLLLVVAGAVFWYK
RHVRGAKGFQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKPTNFTNP
VYATLYMGGHGSRHSLASTDEKRELLGRGPEDEIGDPLA
Download sequence
Identical sequences ENSPCAP00000013518 ENSPCAP00000013518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]