SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000013609 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000013609
Domain Number 1 Region: 242-534
Classification Level Classification E-value
Superfamily L domain-like 2.89e-42
Family Internalin LRR domain 0.021
Further Details:      
 
Domain Number 2 Region: 770-1024
Classification Level Classification E-value
Superfamily PP2C-like 4.84e-37
Family PP2C-like 0.0023
Further Details:      
 
Domain Number 3 Region: 473-695
Classification Level Classification E-value
Superfamily L domain-like 1.56e-25
Family Ngr ectodomain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000013609   Gene: ENSPCAG00000014504   Transcript: ENSPCAT00000014563
Sequence length 1311
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_3729:37860:87086:-1 gene:ENSPCAG00000014504 transcript:ENSPCAT00000014563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRNGSRNCLNRRSRFGSRERDWLREDVKRGCVYLYGAETTTATTITTISSSSDLHLVLC
TVETPASEICAGEGRESLYLQLHGDLVRRLEPTERPLQIVYDYLSRLGFDDPVRRQEEAA
NPDLGCMIRFYGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVV
SQRISTVDLSCYSLEEVPEHLFYSQDITYLNLRHNFMQLERPGGLDSLYRFSQLKGLNLS
HNKLGLFPTLLCEISTLTELNLSCNGIHNLPSQIGSLLNLQTLCLDGNFLSTLPEELGNL
RHLSSLAISFNHFSHIPEVYEKLTTLEKVVMAGNRLEVLNLGVLNRMSHIKHVDLRMNHL
KTVVTENLEGNKYITHVDLRDNQLTDLDLSSLCSLEQLHCERNQLRELTLSGFCLRALCA
NSNRLTAVNVYPVPSLLTSLELSRNLLECIPDWACEAKKIEILDISYNLLTDVSMXXXXX
XXXXXXXXXXXXXXXXXXLVEHIPLEVLDIQHNLRLPDTLFTKLNLRYLNASANSLESLP
SACPGEESLSMLQLLYLTSNLLTDHCIPVLVGHPHLRILHLANNQLQTFPASKLNKLEQL
EELNLSGNKLKTIPTTIANCKRLHTLVAHSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHITTLKIDQKPLPTTDATVTSTFWSHGLAE
MAGQRNKLCISALAVDNFAEGVGAVYGMFDGDRNEELPRLLQCTMADVLLEXXXXXXXXX
XXXXXXXXXXXXKLGMAGQKLGSSALLCYIRPDIADPTSSFSLTVANVGTCQAVLCRSGK
PVFLSKVFSLEQDPEEAQRVKDQKAIITEDNIVNGVTCCTRMLGCTYLYPWILPQPYISS
IPLTIQDELLILGNKALWEHLSYSEAVNAVRRVQDPLAAAKKLCTLAQSYGCQDNVGAMV
VYLNIGEEGCTCEVNGLTFPGPVGFVSTTKDPAKPATPSSSSGIASEFSSEMSTSEVSSE
VGSTASDEHNTVGLDAGLLPRPERRCSLHPAPTSGVFQRQPSCATFSSNQSDNGLDSDDD
QPVEGVITNGSKVEVEVDIHCCRGRDLENSPILRENSPAPCPEEHGRGFFLGIRRQNSVN
SGILLPVSKDKMELQKSPSTSCLYGKKLSNGSIVPLEDSLNLIEVATEAPKKKTGYFAAP
TQLEPDDQFVVPRDLEAEVKEQMKQHQEGRPEPEPSEEDRTEVPEEFDTAL
Download sequence
Identical sequences ENSPCAP00000013609 ENSPCAP00000013609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]