SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000013789 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000013789
Domain Number 1 Region: 3-250
Classification Level Classification E-value
Superfamily L domain-like 6.8e-50
Family Internalin LRR domain 0.038
Further Details:      
 
Domain Number 2 Region: 777-896
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-25
Family PDZ domain 0.0000662
Further Details:      
 
Domain Number 3 Region: 914-1031
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-25
Family PDZ domain 0.0054
Further Details:      
 
Domain Number 4 Region: 1029-1127
Classification Level Classification E-value
Superfamily PDZ domain-like 1.13e-22
Family PDZ domain 0.0000161
Further Details:      
 
Domain Number 5 Region: 659-749
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-18
Family PDZ domain 0.0000631
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000013789   Gene: ENSPCAG00000014585   Transcript: ENSPCAT00000014760
Sequence length 1588
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6459:11920:34446:-1 gene:ENSPCAG00000014585 transcript:ENSPCAT00000014760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFFRLLNLRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFS
GNPLSRLPDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFL
VKLEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCLDVSENRLE
ELPAELGGLALLTDLLLSQNLLQRLPDGIGQLKQLSILKVDQNRLCEVTEAIGDCENLSE
LILTENLLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXLQSLPFALTHLNLKALWLAENQAQPMLRFQTEDDTRTGEKVLTC
YLLPQQPSPGLEDVEKQSSPSEDWSDTQLSRVSVIQFLEAPVGDEDAEEVVSETRGLQRR
ATPHPSELKVMKRSIEERRSEIPCRPGPEPPSTWEEEKRLSTESGLSAASQPSTSTSSEG
PPREADSQNRQVATPASLEEDPEEGYEERFAEDTLLPRGDSEDEEEQPEAPWPLPGGRQR
LIRKDTPHYKKHFISRLPQPEAVVALLQVRQDGEGQAGAGSWHNGPHEPWAPQAEEEEXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXLTLTVVRQTGGLGISIAGGRGSSPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEV
NGVLQSAEHHEAVELRGAGNTVRMRVWRERMVEPENAVTVTPLRPGDDYSPRERRGSSLR
LPLPQPQPEALGPLRQRLAACLVRNEKGLGFSIAGGKGSTPYRAGHTGIFISRIAEGGAA
HRAGTLQVGDRVLSINGVDMTEARHDHAVSLLTAASPTIALLLEREAGAPLSPSPPPHSP
PPPAAASTPTTATAGEPGPPSLPPSLLATALEGPYPVEEIRLPRAGGPLGLSVVGGSDHS
SHPFGIQEPGVFISKVLPRGLAARSGLRVGDRILAVNGQDVREATHQEAVGALLRPCPEL
HLLVRRDPPPPGMQELCIQKAPGEKLGISIRGGAKGHAGNPLDPTDEGVFISKVSPTGAA
GRDGRLRVGLRLLEVDQRSLLGLTHAEAVQLLRSVGDTLTVLVCDGFDTSATAALEVSPG
VIANPFVAAVGRRNSLDSISSVDRELSPEGPGKDRELAGQTPPQEPEATEATGRSTEPLQ
LDYRALAAVPGGGSVQRVPSGASGSPIDEAPNSPGSQQLPSPPSPDELPANVKQAYRTFA
AVPATHPPDGTAVQSCTPGPTASPEQLSFRERQKYFELEVRVPQAEGPPKRVSLVGADDL
RKMQEEEARKLQQKRVQMLRGEEAAAAGGPEAALTLDREAPDEREEDLPWAGPGPAGGLS
PATPPPPGGSVPVRTAKAERRHQERRRMQSPEPPVPERALSPAERRALEAEKRALWRAAR
MKSLEQDALRAQMVLSKSQEGRVKRGPLERLSEAPSPAPTPSPTPLEDLGLQASTSPGWL
FLSGKKFDYRVFAALPSSRPVCDIQSPDFTEDLRSLDKSPSPVAGGGGVLVTLCSSPPPG
ITGPEEVALCSSRRPVRPVRRGLGPVPS
Download sequence
Identical sequences ENSPCAP00000013789 ENSPCAP00000013789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]