SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000013904 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000013904
Domain Number 1 Region: 53-347
Classification Level Classification E-value
Superfamily L domain-like 5.44e-49
Family Ngr ectodomain-like 0.0000000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000013904   Gene: ENSPCAG00000014909   Transcript: ENSPCAT00000014878
Sequence length 360
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_137:910:24839:-1 gene:ENSPCAG00000014909 transcript:ENSPCAT00000014878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKATIILLLLVQVCWAGPFEQRGLFDFMLEDEASGIDSGEGSPEFPEVDLLVPTCPFRCQ
CHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKEGDFKNLKNLHALILVNNNINK
ISPGAFAPLVKLERLYLSKNKLKELPEKMPKTLQELRAHENEITKVRKTVFNGLNQMIVI
ELGTNPLKSSGIENGAFQGMKKLSYIRIADTDITSIPQXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXLGLSFNSISVVDNGSLANAPHLRELHLDNNKLIKVPGGLAEHKYIQVVYL
HNNNISSIGSNDFCPPGYNTKKASYTGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
Download sequence
Identical sequences ENSPCAP00000013904 ENSPCAP00000013904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]