SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000014069 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPCAP00000014069
Domain Number - Region: 419-479
Classification Level Classification E-value
Superfamily L domain-like 0.0129
Family Ngr ectodomain-like 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000014069   Gene: ENSPCAG00000015001   Transcript: ENSPCAT00000015048
Sequence length 751
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_3329:327:86313:1 gene:ENSPCAG00000015001 transcript:ENSPCAT00000015048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHHLQRAISAQQVFREKKESMVIPVPEAESNVNYYNRLYKGEFKQPKQFIHIQPFNLDNE
QPDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNRKNDEASY
EKMLKLRREFSRAITILEMIKRREKTKRELLHLTLEVVEKRYHLGDYGGEILNEVKINRS
EKELYASPATLHNGNHHKVQECKTKHPHHLSLKEETSDVVRQKKKYPKKKAEALVTSQQP
TPESLPVINKSDIKQYDFHSSDEDEFPQVPSPVSDLEENDPDGPCAFRRRAGCQYYAPRL
DQTNRSFENSDLPDLDKLRHRHCLTTLTVPSRCIGFARRRIGRGGRVIMDRISTEHDPVL
KQIDPEMLNGFSSSFQTIDFSSNYSRTNAPNKHCERPSLSELSIRSCRLQCFQPRLLNLQ
DSDSEECTSRKPGQTVNNKRISAASVALLNTSKNGISVTGGITEEQFQTHQQQLVQMQRQ
QLAQLQQKQQSQHSSQQTHPKAQGSSTSDCMSKTLDSASAHFAASAVVSAPVPSRSEVAK
EQNTGHNNINGVVQPSGTSKTLYSTNMALSSSPGISAVQLVRTVGHTTTNHLIPALCTSS
PQTLPMNNSCLTNAVHLNNVSVVSPVNVHINTRTSAPSPTALKLATVAASMDRVPKVTPS
SAISSIARENHEPERLGLNGIAETTVAMEVT
Download sequence
Identical sequences ENSPCAP00000014069 ENSPCAP00000014069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]