SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000014220 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000014220
Domain Number 1 Region: 951-1243
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-77
Family Protein kinases, catalytic subunit 0.00000000136
Further Details:      
 
Domain Number 2 Region: 28-161,222-237
Classification Level Classification E-value
Superfamily L domain-like 1.19e-38
Family L domain 0.00000352
Further Details:      
 
Domain Number 3 Region: 761-909
Classification Level Classification E-value
Superfamily Fibronectin type III 2.91e-23
Family Fibronectin type III 0.00028
Further Details:      
 
Domain Number 4 Region: 481-601
Classification Level Classification E-value
Superfamily Fibronectin type III 3.02e-23
Family Fibronectin type III 0.0000392
Further Details:      
 
Domain Number 5 Region: 322-409
Classification Level Classification E-value
Superfamily L domain-like 5.1e-21
Family L domain 0.00018
Further Details:      
 
Domain Number 6 Region: 603-671,772-794
Classification Level Classification E-value
Superfamily Fibronectin type III 2.22e-17
Family Fibronectin type III 0.0003
Further Details:      
 
Domain Number 7 Region: 191-328
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000286
Family Growth factor receptor domain 0.0000337
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000014220   Gene: ENSPCAG00000015168   Transcript: ENSPCAT00000015206
Sequence length 1300
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_7266:13072:29237:-1 gene:ENSPCAG00000015168 transcript:ENSPCAT00000015206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIPSLWPWIACLLVILLSWGFSLHTLEVCPSLDIRSEVAELRRLENCSVVEGHLQILLM
FTATGEDFRGLSFPHLTQVTDYLLLFRVYGLESLRDLFPNLAVIRGTRLFLGYALVIFEM
PHLRDLGLPALGAVLRGAVRVEKNQELCHLSTIDWGLLQPAPGANHIVGNKLDEECADVC
PGIPGAAGERCARTTFSGHTDYRCWTSSHCQRVCSCPRGLACTAKGECCHTECLGGCSRP
EDPRACVACRHLYFQGACHQACPPGTYQHESWRCVTAEHCASLRSVPGHASTFGIHQGSC
LAQCPPGFTRNGSSIFCQKCEGLCPKECKVGTKTIDSVQAAQELVGCTHVEGSLILNLRQ
GYNLEPELQRSLGLVETITGFLKIKHSFALVSLGFFKNLKLIQGDAMVDGXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYRLEEVTGTRGRQNKAINPRTNGDRAA
CQTRTLRFVSNVTEADRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGTQ
SWNLLDVELPLSRTQEPGVTLAPLKPWTQYAVFVRAITLTIAEDSPHQGAQSPIVYLRTL
PAAPTVPQDVISMSNSSSHLLVRWKPPIQRNGNITYYLVLWQRLAEDGDLYLNDYCHRGL
RLPTSNSDPRFEREDGELEAEVEPGCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNAI
TIPKSPWKVTSINKSPQRDSGRYRRAVGGPRPAGNSSHFEIQEDKVPRERAVLSGLRHFT
EYRIDIHACNHAAHTVGCSAATFVFARTMPHREADGIPGKVVWEASSKSSVLIRWPEPPD
PNGLILKYEIKYRRSGEEATVLCVSRLRYAKFGGVHLALLPPGNYSARVRATSLAGNGSW
TDSVAFYIPGPEEEDSRGLHVFLTVTPVGLMLLIILAALGFFYGKKRNSTLYASVNPEYF
SASDMYIPDEWEVPREQISIIRELGQGSFGMVYEGLARGLEAGKESTPVALKTVNELASP
RERIEFLKEASVMKAFKCHHVVRLLGVVSQGQPTLVIMELMARGDLKSYLRSLRPEAENN
PGLPQPELGDMIQMAGEIADGMAYLAAKKFVHRDLAARNCMVSQDFTVKIGDFGMTRDVY
ETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQV
LKFVMDGGVLEELEGCPPQLQELMSRCWQQNPRLRPTFTHILDSIQEELRPSFRLLSFYY
SPEHQGGRVSLLPTEVEPDSPSAPEEASSNCSPLNGGPWH
Download sequence
Identical sequences ENSPCAP00000014220 ENSPCAP00000014220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]