SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000014262 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000014262
Domain Number 1 Region: 36-220,292-396
Classification Level Classification E-value
Superfamily L domain-like 4.17e-46
Family Ngr ectodomain-like 0.049
Further Details:      
 
Domain Number 2 Region: 534-671
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000201
Family Rhodopsin-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000014262   Gene: ENSPCAG00000015192   Transcript: ENSPCAT00000015251
Sequence length 940
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_1816:35207:149704:-1 gene:ENSPCAG00000015192 transcript:ENSPCAT00000015251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPLGLLCFLALGLRGSAGPSGAAPPLCAAPCICDGDRRVDCSGKGLTGVPEGLSAFTQ
ALDISMNNITQLPEDAFKNFPFLEELRLAGNDLSFIHPKALSGLKELKVLXXXXXXXXXX
XXXXXXXXXXXXXXRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVRPLSNLPTLQ
ALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIKSLGQHCFDGLDNLETXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHLYDNPLSVGNAAFYNSDLHCIV
IRGASMVQWFPNLTGTVHLESLTLTGTKISSIPDNLCQEQKMLRTLDLSYNNIKDLPSFN
GCHALEEISLQRNQICQIKEGTFQSLIFLRILDLSNLIREIHKGAFALGSITNXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAFKPCEYLLGSWMIRLT
VWFIFLVALFFNLLVVLTTFASCTSLPSSKLFIGLISMSNLFMGIYTGILTFLDAVSWGR
FADFGIWWETGSGCKVAGFLAVFSSESAIFLLTLAAIERSLSVMKNGKCSHLKQFRAALV
AFLGAAVACFPLHREYSASPLCLPFPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILPRVKD
Download sequence
Identical sequences ENSPCAP00000014262 ENSPCAP00000014262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]