SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000014302 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000014302
Domain Number 1 Region: 495-780
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.93e-81
Family Protein kinases, catalytic subunit 0.000000134
Further Details:      
 
Domain Number 2 Region: 62-182
Classification Level Classification E-value
Superfamily L domain-like 2.04e-22
Family Ngr ectodomain-like 0.0000019
Further Details:      
 
Domain Number 3 Region: 294-378
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000148
Family I set domains 0.0000129
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000014302
Domain Number - Region: 194-229
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0344
Family I set domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000014302   Gene: ENSPCAG00000015274   Transcript: ENSPCAT00000015294
Sequence length 797
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_7266:31924:50431:1 gene:ENSPCAG00000015274 transcript:ENSPCAT00000015294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPGGRRGQLGRYGGATGRGSLLAWLMLASAGAASCPEACCPHGPSGLRCTQAGALRSLR
YLPGAENLTELYIENQQHLERLELDDLRDLGELRNLTIVKSGLRFVAPDAFRFTPRLSRL
NLSFNALESLSWKTVQGLSLQELVLSGNPLNCSCALHWLQHWEEEGLGRVPEQQLQCPGQ
GPLALVHNASCGVPTLKVLMPNGSVDVGDSVLLRCEVEGRELEKADWILTDLEESSATVM
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPASVQLHRAVELHHW
CIPFTVDGQPAPSLRWFFNGSVLNETNFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNY
TLQATNPSGQAADSVMAAFMDNPFEFNPEDPIPVSFSPVDGNSTSRDPVEKKDETPFGVS
VAVGLAVFACLFLSTLLLVLNKCGRRSKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPT
EGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKM
LVAVKALKEVSESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNR
FLRSHGPDAKLLAGREDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVG
QGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWE
IFTYGKQPWYQLSNTEAIECITQGRELERPRACPLEVYAIMRGCWQREPQQRHSIKDVHA
RLQALAQSPPVYLDVLG
Download sequence
Identical sequences ENSPCAP00000014302 ENSPCAP00000014302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]